StarFunc result for job id O15444

User Input

>input (150 residues)
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNL
PAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSG
NSKLSSSKFSNPISSSKRNVSLLISANSGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15444	1.000	1.000	1.614E-26	150	1.000	1.000	O15444.pdb.gz	CCL25_HUMAN C-C motif chemokine 25 OS=Homo sapiens OX=9606 GN=CCL25 PE=1 SV=2
2	AFDB:O35903	0.567	0.587	4.056E-12	144	0.427	0.444	O35903.pdb.gz	CCL25_MOUSE C-C motif chemokine 25 OS=Mus musculus OX=10090 GN=Ccl25 PE=2 SV=2
3	AFDB:A0A2R8QR67	0.459	0.647	3.096E-7	102	0.233	0.343	A0A2R8QR67.pdb.gz	A0A2R8QR67_DANRE C-C motif chemokine 21-like OS=Danio rerio OX=7955 GN=ccl25a PE=4 SV=1
4	AFDB:A9ZPF2	0.439	0.606	1.035E-6	106	0.240	0.340	A9ZPF2.pdb.gz
5	AFDB:P14844	0.421	0.426	1.720E-6	148	0.200	0.203	P14844.pdb.gz	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
6	AFDB:P10148	0.412	0.417	2.082E-6	148	0.227	0.230	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
7	AFDB:Q9PT03	0.447	0.655	2.684E-6	100	0.173	0.260	Q9PT03.pdb.gz	Q9PT03_ONCMY Chemokine CK-1 OS=Oncorhynchus mykiss OX=8022 PE=4 SV=1
8	AFDB:O00585	0.394	0.439	3.047E-6	134	0.247	0.276	O00585.pdb.gz	CCL21_HUMAN C-C motif chemokine 21 OS=Homo sapiens OX=9606 GN=CCL21 PE=1 SV=1
9	AFDB:P84444	0.368	0.410	3.247E-6	133	0.240	0.271	P84444.pdb.gz	CC21A_MOUSE C-C motif chemokine 21a OS=Mus musculus OX=10090 GN=Ccl21a PE=1 SV=1
10	AFDB:P97884	0.412	0.627	3.247E-6	96	0.187	0.292	P97884.pdb.gz	CCL20_RAT C-C motif chemokine 20 OS=Rattus norvegicus OX=10116 GN=Ccl20 PE=1 SV=1
11	PDB:2l4nA	0.340	0.636	1.111E-4	70	0.167	0.357	2l4nA.pdb.gz
12	PDB:1esrA	0.351	0.641	2.882E-4	76	0.147	0.289	1esrA.pdb.gz
13	PDB:1ha6A	0.331	0.626	4.495E-4	70	0.160	0.343	1ha6A.pdb.gz
14	PDB:2kumA	0.346	0.550	4.790E-4	88	0.100	0.170	2kumA.pdb.gz
15	PDB:2mp1A	0.377	0.687	5.104E-4	77	0.120	0.234	2mp1A.pdb.gz
16	PDB:5ltlB	0.315	0.652	5.104E-4	68	0.153	0.338	5ltlB.pdb.gz
17	PDB:2mpmA	0.352	0.646	5.439E-4	74	0.160	0.324	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
18	PDB:5yamA	0.334	0.658	5.439E-4	69	0.120	0.261	5yamA.pdb.gz
19	PDB:2ra4B	0.339	0.731	7.472E-4	65	0.127	0.292	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
20	PDB:1bo0A	0.338	0.614	1.027E-3	76	0.133	0.263	1bo0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15444	5.44e-110	310	150	1.000	1.000	CCL25_HUMAN C-C motif chemokine 25 OS=Homo sapiens OX=9606 GN=CCL25 PE=1 SV=2
2	O35903	3.17e-37	126	144	0.467	0.486	CCL25_MOUSE C-C motif chemokine 25 OS=Mus musculus OX=10090 GN=Ccl25 PE=2 SV=2
3	A0A2R8QR67	1.62e-12	62.0	102	0.207	0.304	A0A2R8QR67_DANRE C-C motif chemokine 21-like OS=Danio rerio OX=7955 GN=ccl25a PE=4 SV=1
4	F1QBE9	1.05e-11	60.1	106	0.193	0.274	F1QBE9_DANRE Chemokine (C-C motif) ligand 25b OS=Danio rerio OX=7955 GN=ccl25b PE=4 SV=1
5	P86792	1.15e-06	47.4	133	0.193	0.218	CC21B_MOUSE C-C motif chemokine 21b OS=Mus musculus OX=10090 GN=Ccl21b PE=1 SV=1
6	P84444	8.87e-06	44.7	133	0.187	0.211	CC21A_MOUSE C-C motif chemokine 21a OS=Mus musculus OX=10090 GN=Ccl21a PE=1 SV=1
7	O00585	3.07e-05	43.5	134	0.187	0.209	CCL21_HUMAN C-C motif chemokine 21 OS=Homo sapiens OX=9606 GN=CCL21 PE=1 SV=1
8	P97884	1.10e-04	41.2	96	0.187	0.292	CCL20_RAT C-C motif chemokine 20 OS=Rattus norvegicus OX=10116 GN=Ccl20 PE=1 SV=1
9	Q9NRJ3	1.26e-04	41.6	127	0.180	0.213	CCL28_HUMAN C-C motif chemokine 28 OS=Homo sapiens OX=9606 GN=CCL28 PE=1 SV=1
10	P51670	1.57e-04	41.2	122	0.167	0.205	CCL9_MOUSE C-C motif chemokine 9 OS=Mus musculus OX=10090 GN=Ccl9 PE=1 SV=1
11	Q9Y258	2.42e-04	40.0	94	0.160	0.255	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
12	P55773	3.98e-04	40.0	120	0.140	0.175	CCL23_HUMAN C-C motif chemokine 23 OS=Homo sapiens OX=9606 GN=CCL23 PE=1 SV=4
13	Q9Z1X0	6.68e-04	39.7	120	0.127	0.158	CCL27_MOUSE C-C motif chemokine 27 OS=Mus musculus OX=10090 GN=Ccl27 PE=2 SV=2
14	O89093	0.001	38.5	97	0.173	0.268	CCL20_MOUSE C-C motif chemokine 20 OS=Mus musculus OX=10090 GN=Ccl20 PE=1 SV=1
15	O00175	0.003	37.7	119	0.193	0.244	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
16	Q5FVN3	0.005	37.0	117	0.140	0.179	Q5FVN3_RAT Ccl9-like protein OS=Rattus norvegicus OX=10116 GN=Ccl9 PE=1 SV=1
17	Q68FP3	0.005	37.0	115	0.167	0.217	CCL6_RAT C-C motif chemokine 6 OS=Rattus norvegicus OX=10116 GN=Ccl6 PE=3 SV=1
18	Q9JIL2	0.007	37.0	130	0.107	0.123	CCL28_MOUSE C-C motif chemokine 28 OS=Mus musculus OX=10090 GN=Ccl28 PE=1 SV=1
19	Q9I8E0	0.008	35.8	89	0.187	0.315	Q9I8E0_CHICK Chemokine C-C motif ligand 4 OS=Gallus gallus OX=9031 GN=K203 PE=2 SV=1
20	P50229	0.012	35.4	92	0.140	0.228	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	3.7e-12	57.6	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350256	0.998	C-C chemokine receptor type 9
2	9606.ENSP00000416996	0.991	Atypical chemokine receptor 2
3	9606.ENSP00000249887	0.939	Atypical chemokine receptor 4
4	9606.ENSP00000246657	0.888	C-C chemokine receptor type 7
5	9606.ENSP00000343952	0.841	Chemokine (C-C motif) receptor 6
6	9606.ENSP00000362795	0.841	C-X-C chemokine receptor type 3
7	9606.ENSP00000332504	0.820	C-C chemokine receptor type 10
8	9606.ENSP00000386884	0.820	C-X-C chemokine receptor type 4
9	9606.ENSP00000292303	0.818	C-C chemokine receptor type 5
10	9606.ENSP00000326432	0.807	C-C chemokine receptor type 8
11	9606.ENSP00000296140	0.804	C-C chemokine receptor type 1
12	9606.ENSP00000292301	0.802	C-C chemokine receptor type 2
13	9606.ENSP00000441600	0.800	C-C chemokine receptor type 3
14	9606.ENSP00000292174	0.782	C-X-C chemokine receptor type 5
15	9606.ENSP00000395704	0.779	C-X-C chemokine receptor type 6
16	9606.ENSP00000295683	0.776	C-X-C chemokine receptor type 1
17	9606.ENSP00000351059	0.771	CX3C chemokine receptor 1
18	9606.ENSP00000319635	0.762	C-X-C chemokine receptor type 2
19	9606.ENSP00000379140	0.762	Stromal cell-derived factor 1
20	9606.ENSP00000215637	0.753	Mucosal addressin cell adhesion molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048020	1.000	CCR chemokine receptor binding
GO:0008009	1.000	chemokine activity
GO:0005179	0.996	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0050794	0.995	regulation of cellular process
GO:0009605	0.991	response to external stimulus
GO:0042221	0.989	response to chemical
GO:0051716	0.988	cellular response to stimulus
GO:0002682	0.982	regulation of immune system process
GO:0007165	0.980	signal transduction
GO:0006935	0.963	chemotaxis
GO:0006950	0.961	response to stress
GO:0030155	0.960	regulation of cell adhesion
GO:0048518	0.957	positive regulation of biological process
GO:0002376	0.955	immune system process
GO:0048522	0.952	positive regulation of cellular process
GO:0006952	0.949	defense response
GO:0002685	0.938	regulation of leukocyte migration
GO:0006955	0.937	immune response
GO:0060326	0.936	cell chemotaxis
GO:0061844	0.929	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0031640	0.928	killing of cells of another organism
GO:0022407	0.897	regulation of cell-cell adhesion
GO:0002683	0.875	negative regulation of immune system process
GO:0030336	0.847	negative regulation of cell migration
GO:0002686	0.810	negative regulation of leukocyte migration
GO:0007162	0.780	negative regulation of cell adhesion
GO:0045785	0.772	positive regulation of cell adhesion
GO:0007166	0.770	cell surface receptor signaling pathway
GO:0010810	0.745	regulation of cell-substrate adhesion
GO:0007186	0.733	G protein-coupled receptor signaling pathway
GO:0002691	0.696	regulation of cellular extravasation
GO:0022408	0.599	negative regulation of cell-cell adhesion
GO:0001952	0.590	regulation of cell-matrix adhesion
GO:0010811	0.533	positive regulation of cell-substrate adhesion
GO:1903037	0.507	regulation of leukocyte cell-cell adhesion
GO:0050900	0.485	leukocyte migration
GO:1903038	0.380	negative regulation of leukocyte cell-cell adhesion
GO:0001954	0.365	positive regulation of cell-matrix adhesion
GO:0048583	0.339	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.639	extracellular space
GO:0005886	0.498	plasma membrane
GO:0043226	0.371	organelle
GO:0043227	0.337	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]