StarFunc result for job id O15446

User Input

>input (510 residues)
MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRH
VPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEG
PQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPRSALAPNLLTSGKKKKEMQ
VTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLE
PLGVLFPSTTKKRKKPKGKETFEPEDKTVKQEQINTEPLEDTVLSPTKKRKRQKGTEGME
PEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEPGTEAMEPVEPEMKPLESP
GGTMAPQQPEGAKPQAQAALAAPKKKTKKEKQQDATVEPETEVVGPELPDDLEPQAAPTS
TKKKKKKKERGHTVTEPIQPLEPELPGEGQPEARATPGSTKKRKKQSQESRMPETVPQEE
MPGPPLNSESGEEAPTGRDKKRKQQQQQPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15446	0.999	0.999	1.747E-67	510	1.000	1.000	O15446.pdb.gz	RPA34_HUMAN DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1
2	AFDB:Q76KJ5	0.273	0.343	4.766E-31	399	0.463	0.591	Q76KJ5.pdb.gz	RPA34_MOUSE DNA-directed RNA polymerase I subunit RPA34 OS=Mus musculus OX=10090 GN=Polr1g PE=1 SV=2
3	PDB:7vbaN	0.232	0.715	3.980E-26	151	0.296	1.000	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
4	PDB:4c3hN	0.191	0.593	1.349E-4	139	0.059	0.216	4c3hN.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
5	PDB:5w5yN	0.181	0.486	6.280E-4	158	0.067	0.215	5w5yN.pdb.gz	Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
6	PDB:6gylQ	0.090	0.229	9.737E-2	148	0.022	0.074	6gylQ.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
7	PDB:5fywR	0.103	0.229	1.101E-1	199	0.016	0.040	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
8	PDB:7z1lN	0.091	0.228	1.101E-1	153	0.024	0.078	7z1lN.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
9	PDB:3p5jC	0.097	0.292	1.245E-1	116	0.018	0.078	3p5jC.pdb.gz
10	PDB:6yj6C	0.076	0.110	1.498E-1	330	0.016	0.024	6yj6C.pdb.gz
11	PDB:7okxO	0.110	0.420	1.593E-1	106	0.022	0.104	7okxO.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
12	PDB:5iy6S	0.082	0.250	1.915E-1	138	0.006	0.022	5iy6S.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
13	AFDB:A9YTQ3	0.086	0.069	2.006E-1	701	0.155	0.113	A9YTQ3.pdb.gz	AHRR_HUMAN Aryl hydrocarbon receptor repressor OS=Homo sapiens OX=9606 GN=AHRR PE=1 SV=3
14	AFDB:Q9D8C3	0.074	0.040	3.086E-1	1166	0.114	0.050	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
15	AFDB:Q5A1E0	0.070	0.030	5.047E-1	1308	0.122	0.047	Q5A1E0.pdb.gz	IFF5_CANAL Cell wall protein IFF5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IFF5 PE=1 SV=1
16	AFDB:E7F4C0	0.067	0.036	7.300E-1	1104	0.171	0.079	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
17	AFDB:Q9VBH3	0.073	0.044	1.624	920	0.151	0.084	Q9VBH3.pdb.gz	Q9VBH3_DROME Dysfusion, isoform D OS=Drosophila melanogaster OX=7227 GN=dysf PE=4 SV=4
18	AFDB:Q9S732	0.074	0.077	1.837	490	0.125	0.131	Q9S732.pdb.gz	Q9S732_ARATH HSP20-like chaperones superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SLI1 PE=1 SV=1
19	AFDB:Q95TJ2	0.053	0.027	2.498	1261	0.186	0.075	Q95TJ2.pdb.gz	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
20	AFDB:A0A024R1V3	0.049	0.034	2.825	966	0.153	0.081	A0A024R1V3.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15446	0.0	994	510	1.000	1.000	RPA34_HUMAN DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1
2	Q76KJ5	4.79e-116	350	399	0.463	0.591	RPA34_MOUSE DNA-directed RNA polymerase I subunit RPA34 OS=Mus musculus OX=10090 GN=Polr1g PE=1 SV=2
3	A0A0R4IBK5	0.26	36.6	5209	0.104	0.010	R213A_DANRE E3 ubiquitin-protein ligase rnf213-alpha OS=Danio rerio OX=7955 GN=rnf213a PE=3 SV=1
4	Q8I3E5	2.5	33.5	2270	0.080	0.018	Q8I3E5_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0900100 PE=4 SV=1
5	Q9I9L7	3.2	32.7	383	0.037	0.050	CASPA_DANRE Caspase a OS=Danio rerio OX=7955 GN=caspa PE=1 SV=1
6	P34926	3.8	32.7	2774	0.065	0.012	MAP1A_RAT Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08208 RNA_polI_A34	1.5e-33	128.2	DNA-directed RNA polymerase I subunit RPA34.5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367029	0.995	DNA-directed RNA polymerase I subunit RPA49
2	9606.ENSP00000462664	0.982	DNA polymerase iota
3	9606.ENSP00000478303	0.964	DNA-directed RNA polymerases I, II, and III subunit RPABC1
4	9606.ENSP00000361465	0.959	DNA-directed RNA polymerases I and III subunit RPAC1
5	9606.ENSP00000302478	0.948	DNA-directed RNA polymerases I and III subunit RPAC2
6	9606.ENSP00000263857	0.946	DNA-directed RNA polymerase I subunit RPA1
7	9606.ENSP00000403852	0.939	DNA-directed RNA polymerases I, II, and III subunit RPABC2
8	9606.ENSP00000339976	0.920	TATA box-binding protein-associated factor RNA polymerase I subunit A
9	9606.ENSP00000342889	0.915	DNA-directed RNA polymerases I, II, and III subunit RPABC4
10	9606.ENSP00000444136	0.910	DNA-directed RNA polymerase I subunit RPA2
11	9606.ENSP00000324124	0.902	DNA-directed RNA polymerases I, II, and III subunit RPABC5
12	9606.ENSP00000483903	0.902	Histone H2B type 1-N
13	9606.ENSP00000274764	0.900	Histone H2B type 1-A
14	9606.ENSP00000289316	0.900	Histone H2B type 1-D
15	9606.ENSP00000296417	0.900	Histone H2A.Z
16	9606.ENSP00000308405	0.900	Histone H2A.V
17	9606.ENSP00000324806	0.900	Glycogen synthase kinase-3 beta
18	9606.ENSP00000328484	0.900	Histone H2A type 1-J
19	9606.ENSP00000332194	0.900	Histone H2A type 2-C
20	9606.ENSP00000341094	0.900	Histone H2A type 1-D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.879	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006351	0.985	DNA-templated transcription
GO:0051716	0.977	cellular response to stimulus
GO:0050794	0.977	regulation of cellular process
GO:0007166	0.959	cell surface receptor signaling pathway
GO:0007167	0.944	enzyme-linked receptor protein signaling pathway
GO:0007169	0.885	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0098781	0.858	ncRNA transcription
GO:0016072	0.853	rRNA metabolic process
GO:0009303	0.713	rRNA transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005829	0.999	cytosol
GO:0005667	0.989	transcription regulator complex
GO:0005739	0.986	mitochondrion
GO:0001650	0.986	fibrillar center
GO:0000120	0.968	RNA polymerase I transcription regulator complex
GO:0140535	0.671	intracellular protein-containing complex
GO:1990234	0.649	transferase complex
GO:0030880	0.487	RNA polymerase complex
GO:0000428	0.469	DNA-directed RNA polymerase complex
GO:0055029	0.460	nuclear DNA-directed RNA polymerase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]