StarFunc result for job id O15455

User Input

>input (904 residues)
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA
FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN
NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK
LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHL
NMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP
SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN
NLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNW
INETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV
LLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKE
DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
NSVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LN63	0.933	0.932	0.000	905	0.801	0.800	F1LN63.pdb.gz	F1LN63_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=3 SV=1
2	AFDB:O15455	1.000	1.000	0.000	904	1.000	1.000	O15455.pdb.gz	TLR3_HUMAN Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1
3	AFDB:Q0PQ88	0.783	0.790	1.164E-97	896	0.605	0.610	Q0PQ88.pdb.gz	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2
4	PDB:7wv3A	0.731	0.986	8.817E-94	668	0.739	1.000	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
5	AFDB:B8JIL3	0.708	0.709	3.318E-74	903	0.469	0.470	B8JIL3.pdb.gz
6	AFDB:A0A2R8RTN4	0.456	0.435	4.108E-37	955	0.273	0.259	A0A2R8RTN4.pdb.gz	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
7	AFDB:Q6R5N8	0.464	0.426	1.107E-35	991	0.264	0.241	Q6R5N8.pdb.gz	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
8	AFDB:Q5ZJ34	0.424	0.398	1.738E-35	972	0.252	0.235	Q5ZJ34.pdb.gz	Q5ZJ34_CHICK TIR domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_21a21 PE=2 SV=1
9	AFDB:A0A286Y971	0.529	0.538	1.105E-34	886	0.237	0.242	A0A286Y971.pdb.gz
10	AFDB:G3V6F8	0.500	0.517	9.198E-33	871	0.222	0.231	G3V6F8.pdb.gz	G3V6F8_RAT Toll-like receptor 5 OS=Rattus norvegicus OX=10116 GN=Tlr5 PE=3 SV=1
11	AFDB:Q5GR02	0.490	0.510	1.320E-32	862	0.244	0.256	Q5GR02.pdb.gz	Q5GR02_CHICK Toll-like receptor 5 OS=Gallus gallus OX=9031 GN=TLR5 PE=3 SV=1
12	PDB:3j0aA	0.484	0.539	1.780E-22	797	0.218	0.247	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
13	PDB:3t6qA	0.472	0.658	1.356E-21	601	0.183	0.275	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:3b2dA	0.481	0.672	3.487E-19	601	0.167	0.251	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:6gffI	0.368	0.539	7.473E-16	551	0.169	0.278	6gffI.pdb.gz
16	PDB:7tvfD	0.348	0.565	1.753E-12	515	0.152	0.266	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
17	PDB:7wrqA	0.295	0.406	3.943E-11	566	0.157	0.251	7wrqA.pdb.gz
18	PDB:1xcdA	0.145	0.309	2.084E-7	305	0.086	0.256	1xcdA.pdb.gz
19	PDB:7p5vB	0.264	0.317	3.127E-7	732	0.094	0.116	7p5vB.pdb.gz
20	PDB:6hkwA	0.175	0.343	4.099E-7	306	0.084	0.248	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXV2	0.0	1420	927	0.802	0.782	A0A0G2JXV2_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=1 SV=1
2	F1LN63	0.0	1422	905	0.802	0.801	F1LN63_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=3 SV=1
3	O15455	0.0	1840	904	1.000	1.000	TLR3_HUMAN Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1
4	Q0PQ88	0.0	1089	896	0.608	0.614	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2
5	Q32PW5	0.0	758	903	0.479	0.480	Q32PW5_DANRE Toll-like receptor 3 OS=Danio rerio OX=7955 GN=zgc:123006 PE=1 SV=1
6	Q6PCD4	0.0	1754	870	0.956	0.993	Q6PCD4_HUMAN TLR3 protein (Fragment) OS=Homo sapiens OX=9606 GN=TLR3 PE=2 SV=1
7	Q7TNI8	0.0	1420	905	0.802	0.801	Q7TNI8_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=2 SV=1
8	Q99MB1	0.0	1406	905	0.793	0.792	TLR3_MOUSE Toll-like receptor 3 OS=Mus musculus OX=10090 GN=Tlr3 PE=1 SV=2
9	Q5ZJ34	7.56e-56	211	972	0.259	0.241	Q5ZJ34_CHICK TIR domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_21a21 PE=2 SV=1
10	A0A2R8RTN4	5.77e-55	208	955	0.303	0.287	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
11	Q6R5N8	5.68e-50	193	991	0.280	0.255	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
12	Q5GQ97	5.17e-47	184	1046	0.296	0.256	Q5GQ97_CHICK Toll-like receptor 7 (Fragment) OS=Gallus gallus OX=9031 GN=TLR7 PE=3 SV=1
13	Q5ZJD0	2.72e-45	179	1059	0.292	0.249	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
14	Q9EQU3	2.87e-44	176	1032	0.277	0.242	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
15	F8W3J5	3.71e-44	174	881	0.262	0.269	F8W3J5_DANRE Toll-like receptor 5b OS=Danio rerio OX=7955 GN=tlr5 PE=1 SV=1
16	Q9NYK1	6.32e-43	171	1049	0.260	0.224	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
17	B3DIN1	3.62e-42	168	875	0.257	0.265	B3DIN1_DANRE Tlr5b protein OS=Danio rerio OX=7955 GN=tlr5b PE=1 SV=1
18	Q6Y1S0	4.75e-42	169	1032	0.287	0.251	Q6Y1S0_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
19	F8W4F1	1.11e-41	167	881	0.264	0.271	F8W4F1_DANRE Toll-like receptor 5 OS=Danio rerio OX=7955 GN=tlr5a PE=3 SV=2
20	O60602	2.43e-41	166	858	0.222	0.234	TLR5_HUMAN Toll-like receptor 5 OS=Homo sapiens OX=9606 GN=TLR5 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	32	16.4	Leucine rich repeat C-terminal domain
2	PF01462 LRRNT	15	16.6	Leucine rich repeat N-terminal domain
3	PF00560 LRR_1	6.3e-08	42.9	Leucine Rich Repeat
4	PF12799 LRR_4	1e-28	110.0	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	7.9e-18	76.1	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	5.1e-07	40.3	Leucine Rich repeat
7	PF13855 LRR_8	3.5e-75	259.0	Leucine rich repeat
8	PF14580 LRR_9	3.7e-05	34.8	Leucine-rich repeat
9	PF01582 TIR	5.3e-05	34.6	TIR domain
10	PF13676 TIR_2	0.018	27.1	TIR domain
11	PF17968 Tlr3_TMD	4e-15	67.1	Toll-like receptor 3 trans-membrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296795

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000248244	0.999	TIR domain-containing adapter molecule 1
2	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
3	9606.ENSP00000401399	0.998	Myeloid differentiation primary response protein MyD88
4	9606.ENSP00000227471	0.992	Protein unc-93 homolog B1
5	9606.ENSP00000351273	0.987	Caspase-8
6	9606.ENSP00000329967	0.982	Serine/threonine-protein kinase TBK1
7	9606.ENSP00000358997	0.979	Interleukin-1 receptor-associated kinase 1
8	9606.ENSP00000454207	0.967	TNF receptor-associated factor 3
9	9606.ENSP00000259808	0.960	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000471896	0.960	Interferon regulatory factor 3
11	9606.ENSP00000369581	0.952	Interferon beta
12	9606.ENSP00000380697	0.951	Interferon regulatory factor 7
13	9606.ENSP00000477613	0.949	Baculoviral IAP repeat-containing protein 2
14	9606.ENSP00000263642	0.947	Interferon-induced helicase C domain-containing protein 1
15	9606.ENSP00000263464	0.945	Baculoviral IAP repeat-containing protein 3
16	9606.ENSP00000362680	0.942	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000316176	0.930	Ubiquitin-conjugating enzyme E2 N
18	9606.ENSP00000369213	0.930	Probable ATP-dependent RNA helicase DDX58
19	9606.ENSP00000340305	0.927	Ubiquitin-conjugating enzyme E2 variant 1
20	9606.ENSP00000441543	0.912	Polyubiquitin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003725	1.000	double-stranded RNA binding
GO:0042802	0.902	identical protein binding
GO:0060089	0.878	molecular transducer activity
GO:0038023	0.871	signaling receptor activity
GO:0005102	0.640	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.989	signal transduction
GO:0009605	0.988	response to external stimulus
GO:0048522	0.988	positive regulation of cellular process
GO:0002376	0.985	immune system process
GO:0006950	0.984	response to stress
GO:0042221	0.982	response to chemical
GO:0002764	0.975	immune response-regulating signaling pathway
GO:0009615	0.972	response to virus
GO:0002757	0.971	immune response-activating signaling pathway
GO:0002218	0.970	activation of innate immune response
GO:0019222	0.967	regulation of metabolic process
GO:0010033	0.964	response to organic substance
GO:0002221	0.962	pattern recognition receptor signaling pathway
GO:0010468	0.959	regulation of gene expression
GO:0032501	0.957	multicellular organismal process
GO:0006955	0.954	immune response
GO:0009893	0.946	positive regulation of metabolic process
GO:0045087	0.943	innate immune response
GO:0001817	0.930	regulation of cytokine production
GO:0010604	0.924	positive regulation of macromolecule metabolic process
GO:0043330	0.922	response to exogenous dsRNA
GO:0023051	0.912	regulation of signaling
GO:0010646	0.912	regulation of cell communication
GO:0001819	0.910	positive regulation of cytokine production
GO:0009966	0.883	regulation of signal transduction
GO:0023056	0.866	positive regulation of signaling
GO:0010647	0.866	positive regulation of cell communication
GO:0009967	0.848	positive regulation of signal transduction
GO:0006954	0.842	inflammatory response
GO:0071345	0.836	cellular response to cytokine stimulus
GO:0007249	0.831	I-kappaB kinase/NF-kappaB signaling
GO:0032502	0.816	developmental process
GO:0080090	0.806	regulation of primary metabolic process
GO:0051171	0.806	regulation of nitrogen compound metabolic process
GO:0031323	0.806	regulation of cellular metabolic process
GO:0001775	0.777	cell activation
GO:0044093	0.758	positive regulation of molecular function
GO:0051607	0.754	defense response to virus
GO:1902531	0.749	regulation of intracellular signal transduction
GO:1902533	0.744	positive regulation of intracellular signal transduction
GO:0007166	0.741	cell surface receptor signaling pathway
GO:0031326	0.737	regulation of cellular biosynthetic process
GO:0019219	0.715	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.711	regulation of DNA-templated transcription
GO:0042981	0.702	regulation of apoptotic process
GO:0002224	0.695	toll-like receptor signaling pathway
GO:0034341	0.682	response to type II interferon
GO:0008152	0.677	metabolic process
GO:0032479	0.666	regulation of type I interferon production
GO:0071346	0.652	cellular response to type II interferon
GO:0032675	0.639	regulation of interleukin-6 production
GO:0032642	0.639	regulation of chemokine production
GO:0035456	0.632	response to interferon-beta
GO:0002269	0.632	leukocyte activation involved in inflammatory response
GO:0002274	0.619	myeloid leukocyte activation
GO:0032481	0.606	positive regulation of type I interferon production
GO:0032677	0.603	regulation of interleukin-8 production
GO:0043068	0.591	positive regulation of programmed cell death
GO:0032722	0.587	positive regulation of chemokine production
GO:0032755	0.584	positive regulation of interleukin-6 production
GO:0071704	0.580	organic substance metabolic process
GO:0061900	0.575	glial cell activation
GO:0042116	0.555	macrophage activation
GO:0032757	0.549	positive regulation of interleukin-8 production
GO:0032648	0.547	regulation of interferon-beta production
GO:0031325	0.539	positive regulation of cellular metabolic process
GO:0044238	0.529	primary metabolic process
GO:0048856	0.527	anatomical structure development
GO:0006807	0.509	nitrogen compound metabolic process
GO:0032728	0.486	positive regulation of interferon-beta production
GO:0071407	0.473	cellular response to organic cyclic compound
GO:1901699	0.469	cellular response to nitrogen compound
GO:0071260	0.468	cellular response to mechanical stimulus
GO:0048519	0.462	negative regulation of biological process
GO:1901700	0.452	response to oxygen-containing compound
GO:0062207	0.441	regulation of pattern recognition receptor signaling pathway
GO:0051173	0.439	positive regulation of nitrogen compound metabolic process
GO:0062208	0.409	positive regulation of pattern recognition receptor signaling pathway
GO:0044237	0.364	cellular metabolic process
GO:0043170	0.351	macromolecule metabolic process
GO:0007275	0.328	multicellular organism development
GO:1901564	0.323	organonitrogen compound metabolic process
GO:0048523	0.316	negative regulation of cellular process
GO:0051246	0.305	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.997	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0012505	0.985	endomembrane system
GO:0098588	0.978	bounding membrane of organelle
GO:0005886	0.947	plasma membrane
GO:0031410	0.846	cytoplasmic vesicle
GO:0098852	0.785	lytic vacuole membrane
GO:0005765	0.758	lysosomal membrane
GO:0005829	0.509	cytosol
GO:0009986	0.382	cell surface
GO:0030659	0.348	cytoplasmic vesicle membrane
GO:0005768	0.309	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]