StarFunc result for job id O15466

User Input

>input (376 residues)
MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRC
LELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTT
QKNTPLGTKLKYEVDTSGIYHINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGR
EINSADFVFRCNLPPISEKYTMDVGVKTDVVTVNPSIITERFHKLEKWRRPFYRVLQVYE
NASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQYLVNVSRYWLSLGVRAKRIS
TGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAMPSEIFNFLHL
HSRGILRVHTGTCSCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15466	1.000	1.000	3.220E-79	376	1.000	1.000	O15466.pdb.gz	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
2	AFDB:Q6ZXC8	0.928	0.928	1.959E-68	376	0.854	0.854	Q6ZXC8.pdb.gz	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
3	AFDB:P70126	0.878	0.801	1.217E-66	412	0.851	0.777	P70126.pdb.gz	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2
4	AFDB:Q6ZXA0	0.742	0.777	9.057E-41	359	0.388	0.407	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
5	AFDB:Q8K4T1	0.810	0.767	5.010E-40	398	0.343	0.324	Q8K4T1.pdb.gz	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
6	AFDB:P61647	0.805	0.762	7.571E-40	398	0.346	0.327	P61647.pdb.gz	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
7	AFDB:G3V7T2	0.739	0.780	8.500E-39	356	0.370	0.390	G3V7T2.pdb.gz	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
8	AFDB:F1R0F8	0.743	0.778	3.097E-36	359	0.332	0.348	F1R0F8.pdb.gz
9	AFDB:Q6KC03	0.712	0.746	3.055E-30	358	0.269	0.282	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
10	AFDB:Q1LVN2	0.726	0.717	9.370E-30	381	0.282	0.278	Q1LVN2.pdb.gz
11	PDB:6aplC	0.502	0.603	1.190E-11	306	0.170	0.209	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:4qa0A	0.155	0.157	2.102E-2	371	0.130	0.132	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
13	PDB:2plaA	0.109	0.116	2.824E-2	343	0.040	0.044	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
14	PDB:2yimA	0.118	0.122	5.402E-2	355	0.064	0.068	2yimA.pdb.gz	The Enolization Chemistry of a Thioester-Dependent Racemase: The 1.4 A Crystal Structure of a Reaction Intermediate Complex Characterized by Detailed Qm/Mm Calculations.
15	PDB:1ydhA	0.145	0.232	5.730E-2	184	0.048	0.098	1ydhA.pdb.gz
16	PDB:1wdlA	0.126	0.078	6.840E-2	715	0.098	0.052	1wdlA.pdb.gz	Structural basis for channelling mechanism of a fatty acid beta-oxidation multienzyme complex
17	PDB:1eudB	0.141	0.136	8.163E-2	395	0.051	0.048	1eudB.pdb.gz
18	PDB:3a58F	0.129	0.208	8.659E-2	181	0.059	0.122	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
19	PDB:3geiA	0.152	0.137	9.744E-2	428	0.061	0.054	3geiA.pdb.gz
20	PDB:1gsoA	0.073	0.068	1.034E-1	419	0.045	0.041	1gsoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15466	0.0	788	376	1.000	1.000	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
2	P70126	0.0	666	412	0.851	0.777	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2
3	Q6ZXC8	0.0	683	376	0.854	0.854	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
4	Q6ZXA0	2.45e-93	285	359	0.359	0.376	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
5	Q8K4T1	3.40e-87	271	398	0.338	0.319	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
6	P61647	8.50e-86	267	398	0.330	0.312	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
7	Q64687	1.01e-85	265	355	0.348	0.369	SIA8A_MOUSE Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia1 PE=1 SV=2
8	G3V7T2	3.66e-85	264	356	0.351	0.371	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
9	Q92185	9.37e-84	260	356	0.340	0.360	SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA1 PE=1 SV=1
10	Q8QH83	1.02e-52	181	381	0.301	0.297	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
11	Q92187	2.80e-47	166	359	0.255	0.267	SIA8D_HUMAN CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA4 PE=1 SV=1
12	Q64690	1.00e-46	165	359	0.255	0.267	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
13	Q64692	1.11e-46	164	359	0.258	0.270	SIA8D_MOUSE CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia4 PE=2 SV=1
14	Q07977	4.02e-46	164	375	0.239	0.240	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1
15	O35696	5.28e-46	163	375	0.239	0.240	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
16	Q92186	5.39e-46	163	375	0.239	0.240	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
17	A1KQY6	5.60e-46	165	454	0.298	0.247	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
18	Q6KC03	3.62e-44	158	358	0.237	0.249	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
19	B0CN48	1.10e-41	152	374	0.234	0.235	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
20	Q64689	1.32e-37	141	380	0.215	0.213	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	7.1e-68	240.7	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417583	0.961	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
2	9606.ENSP00000341562	0.960	Beta-1,4 N-acetylgalactosaminyltransferase 1
3	9606.ENSP00000362235	0.950	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
4	9606.ENSP00000329214	0.945	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
5	9606.ENSP00000336733	0.924	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
6	9606.ENSP00000377257	0.924	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
7	9606.ENSP00000428540	0.922	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
8	9606.ENSP00000376587	0.917	Acetyl-coenzyme A transporter 1
9	9606.ENSP00000379353	0.912	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
10	9606.ENSP00000229329	0.768	N-acylneuraminate cytidylyltransferase
11	9606.ENSP00000297273	0.748	N-acetylneuraminate 9-O-acetyltransferase
12	9606.ENSP00000302441	0.722	N-acylneuraminate-9-phosphatase
13	9606.ENSP00000258317	0.714	N-acetylneuraminate lyase
14	9606.ENSP00000379839	0.638	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
15	9606.ENSP00000364782	0.625	Sialidase-1
16	9606.ENSP00000300605	0.606	Haloacid dehalogenase like hydrolase domain containing 2
17	9606.ENSP00000210444	0.570	Sialic acid synthase
18	9606.ENSP00000390784	0.566	Beta-1,3-galactosyltransferase 4
19	9606.ENSP00000269159	0.558	Inositol monophosphatase 2
20	9606.ENSP00000260403	0.535	Transmembrane protein 62

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.975	binding
GO:0005515	0.964	protein binding
GO:0003828	0.588	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:1901137	0.992	carbohydrate derivative biosynthetic process
GO:1901566	0.992	organonitrogen compound biosynthetic process
GO:0044249	0.991	cellular biosynthetic process
GO:0006688	0.903	glycosphingolipid biosynthetic process
GO:0005975	0.538	carbohydrate metabolic process
GO:0043603	0.354	amide metabolic process
GO:0043170	0.300	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:19313	0.588	an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+)
EC:2.4.99.8	0.588	Transferred entry: 2.4.3.8.

[back to server]