StarFunc result for job id O15479

User Input

>input (319 residues)
MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQ
EPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQ
FLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTF
IDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSV
FGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTP
CAFPTHYEEALKDEEKAGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15479	1.000	1.000	1.231E-50	319	1.000	1.000	O15479.pdb.gz	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3
2	AFDB:O15481	0.547	0.510	4.924E-31	346	0.655	0.604	O15481.pdb.gz	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
3	AFDB:A2A9R3	0.556	0.338	1.745E-28	556	0.527	0.302	A2A9R3.pdb.gz	MAGB4_MOUSE Melanoma-associated antigen B4 OS=Mus musculus OX=10090 GN=Mageb4 PE=1 SV=1
4	AFDB:O15480	0.393	0.363	1.343E-25	346	0.495	0.457	O15480.pdb.gz	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
5	AFDB:Q8BQR7	0.382	0.373	5.990E-25	327	0.451	0.440	Q8BQR7.pdb.gz	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
6	AFDB:Q8N7X4	0.454	0.371	4.759E-23	407	0.357	0.280	Q8N7X4.pdb.gz	MAGB6_HUMAN Melanoma-associated antigen B6 OS=Homo sapiens OX=9606 GN=MAGEB6 PE=1 SV=2
7	AFDB:Q9CPR8	0.398	0.454	2.485E-20	279	0.310	0.355	Q9CPR8.pdb.gz	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
8	AFDB:O60732	0.367	0.124	1.049E-19	1142	0.351	0.098	O60732.pdb.gz	MAGC1_HUMAN Melanoma-associated antigen C1 OS=Homo sapiens OX=9606 GN=MAGEC1 PE=1 SV=3
9	AFDB:Q96MG7	0.401	0.420	1.172E-19	304	0.339	0.355	Q96MG7.pdb.gz	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
10	AFDB:P43355	0.330	0.340	1.726E-19	309	0.370	0.382	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
11	PDB:7qcdE	0.325	0.390	4.193E-7	261	0.129	0.157	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.276	0.322	2.821E-5	270	0.122	0.144	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:7a6hO	0.162	0.109	5.144E-3	512	0.050	0.031	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	PDB:5hs7A	0.193	0.508	1.394E-2	102	0.050	0.157	5hs7A.pdb.gz
15	PDB:3cuqA	0.185	0.255	2.295E-2	219	0.069	0.100	3cuqA.pdb.gz
16	PDB:1w7pD	0.181	0.308	2.425E-2	171	0.078	0.146	1w7pD.pdb.gz
17	PDB:7d58O	0.189	0.130	3.199E-2	490	0.047	0.031	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:4a0kA	0.155	0.077	7.342E-2	719	0.078	0.035	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
19	PDB:7egbA	0.169	0.104	8.202E-2	558	0.082	0.047	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:7eghA	0.169	0.094	9.163E-2	630	0.060	0.030	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15479	0.0	654	319	1.000	1.000	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3
2	O15481	2.20e-131	379	346	0.658	0.607	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
3	A2A9R3	1.93e-120	359	556	0.555	0.318	MAGB4_MOUSE Melanoma-associated antigen B4 OS=Mus musculus OX=10090 GN=Mageb4 PE=1 SV=1
4	Q96M61	7.37e-104	309	343	0.527	0.490	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
5	O15480	2.13e-102	305	346	0.520	0.480	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
6	Q96LZ2	6.69e-90	274	347	0.476	0.438	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
7	Q8BQR7	1.01e-87	268	327	0.455	0.443	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
8	P43363	1.43e-77	243	369	0.411	0.355	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
9	G5E962	1.80e-77	244	400	0.404	0.323	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
10	Q8N7X4	1.86e-77	244	407	0.386	0.302	MAGB6_HUMAN Melanoma-associated antigen B6 OS=Homo sapiens OX=9606 GN=MAGEB6 PE=1 SV=2
11	P43364	4.44e-77	244	429	0.404	0.301	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	Q1RN33	3.24e-71	225	317	0.417	0.420	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
13	P43358	5.81e-71	224	317	0.417	0.420	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
14	P43361	4.92e-70	222	318	0.389	0.390	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
15	P43355	1.33e-64	207	309	0.382	0.395	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
16	P43362	2.01e-63	205	315	0.301	0.305	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
17	Q9UBF1	6.97e-63	205	373	0.342	0.292	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1
18	P43357	4.54e-62	201	314	0.379	0.385	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
19	P43365	1.30e-60	197	314	0.382	0.389	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
20	P43360	9.22e-59	193	314	0.382	0.389	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14957 BORG_CEP	2.2e+02	14.3	Cdc42 effector
2	PF01454 MAGE	1e-09	50.0	MAGE homology domain
3	PF12440 MAGE_N	2.6e-21	87.4	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.777	Histone deacetylase 1
2	9606.ENSP00000404123	0.654	G antigen 12F
3	9606.ENSP00000478568	0.654	G antigen 2E
4	9606.ENSP00000416249	0.651	G antigen 12G
5	9606.ENSP00000355421	0.632	G antigen 2A
6	9606.ENSP00000484668	0.631	G antigen 1
7	9606.ENSP00000338796	0.622	Synovial sarcoma, X breakpoint 2
8	9606.ENSP00000305465	0.602	Protein disulfide-isomerase-like protein of the testis
9	9606.ENSP00000276127	0.599	CPX chromosome region, candidate 1
10	9606.ENSP00000359546	0.587	Sperm protein associated with the nucleus on the X chromosome D
11	9606.ENSP00000351884	0.580	Sperm protein associated with the nucleus on the X chromosome C
12	9606.ENSP00000366118	0.557	Protein SSX1
13	9606.ENSP00000312415	0.551	Synovial sarcoma, X breakpoint 5
14	9606.ENSP00000359549	0.542	Belongs to the SPAN-X family
15	9606.ENSP00000359550	0.542	Sperm protein associated with the nucleus, X-linked, family member A1
16	9606.ENSP00000286049	0.530	X antigen family, member 2B
17	9606.ENSP00000469011	0.524	Synovial sarcoma, X breakpoint 4
18	9606.ENSP00000469394	0.524	Protein SSX4
19	9606.ENSP00000364110	0.517	PAGE family member 2B
20	9606.ENSP00000342240	0.516	X antigen family member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048523	0.771	negative regulation of cellular process
GO:0019222	0.644	regulation of metabolic process
GO:0060255	0.592	regulation of macromolecule metabolic process
GO:0080090	0.590	regulation of primary metabolic process
GO:0051171	0.583	regulation of nitrogen compound metabolic process
GO:0009987	0.508	cellular process
GO:0031323	0.395	regulation of cellular metabolic process
GO:0010468	0.358	regulation of gene expression
GO:0019219	0.353	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.341	positive regulation of biological process
GO:0009892	0.317	negative regulation of metabolic process
GO:2001141	0.310	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.986	nucleus
GO:0031981	0.802	nuclear lumen
GO:0005654	0.773	nucleoplasm
GO:0005829	0.727	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]