StarFunc result for job id O15498

User Input

>input (198 residues)
MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVK
EQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHY
PALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQ
SKAFYKTARKQNSCCAIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D2J0	0.998	0.998	2.609E-40	198	1.000	1.000	A4D2J0.pdb.gz	A4D2J0_HUMAN SNARE protein Ykt6 OS=Homo sapiens OX=9606 GN=YKT6 PE=1 SV=1
2	PDB:6j7fC	0.948	0.962	2.591E-33	195	0.985	1.000	6j7fC.pdb.gz	Complex of GGTaseIII, farnesyl-Ykt6 (C-terminal methylated), and GGPP
3	AFDB:O60073	0.917	0.921	9.510E-25	197	0.540	0.543	O60073.pdb.gz	YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ykt6 PE=3 SV=1
4	AFDB:P36015	0.944	0.935	5.120E-24	200	0.475	0.470	P36015.pdb.gz	YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKT6 PE=1 SV=1
5	AFDB:Q5AI79	0.930	0.921	8.795E-24	200	0.449	0.445	Q5AI79.pdb.gz	Q5AI79_CANAL Synaptobrevin homolog YKT6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YKT6 PE=3 SV=1
6	AFDB:Q6FW27	0.906	0.877	4.735E-23	205	0.475	0.459	Q6FW27.pdb.gz	YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=YKT6 PE=3 SV=1
7	AFDB:F4KDI1	0.921	0.828	1.217E-21	221	0.460	0.412	F4KDI1.pdb.gz	F4KDI1_ARATH SNARE-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=YKT61 PE=1 SV=1
8	AFDB:Q38D47	0.903	0.873	1.548E-21	205	0.389	0.376	Q38D47.pdb.gz	Q38D47_TRYB2 Vesicle-associated membrane protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4610 PE=3 SV=1
9	AFDB:Q9ZRD6	0.910	0.906	2.824E-21	199	0.460	0.457	Q9ZRD6.pdb.gz	YKT61_ARATH VAMP-like protein YKT61 OS=Arabidopsis thaliana OX=3702 GN=YKT61 PE=1 SV=1
10	AFDB:Q9LVM9	0.885	0.881	5.152E-21	199	0.419	0.417	Q9LVM9.pdb.gz	YKT62_ARATH VAMP-like protein YKT62 OS=Arabidopsis thaliana OX=3702 GN=YKT62 PE=1 SV=1
11	AFDB:Q54ES8	0.879	0.862	2.181E-20	202	0.439	0.431	Q54ES8.pdb.gz	YKT6_DICDI Putative synaptobrevin homolog YKT6 OS=Dictyostelium discoideum OX=44689 GN=ykt6 PE=1 SV=1
12	PDB:2nupC	0.478	0.648	1.331E-6	137	0.136	0.197	2nupC.pdb.gz	The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
13	PDB:2j3tC	0.353	0.460	1.809E-3	141	0.101	0.142	2j3tC.pdb.gz
14	PDB:7b6dC	0.361	0.451	2.926E-3	145	0.152	0.207	7b6dC.pdb.gz
15	PDB:4ftxA	0.329	0.398	5.668E-3	158	0.106	0.133	4ftxA.pdb.gz
16	PDB:7q3eB	0.307	0.157	6.788E-3	503	0.136	0.054	7q3eB.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
17	PDB:4hmyS	0.343	0.443	8.634E-3	145	0.076	0.103	4hmyS.pdb.gz	Structural Basis for Recruitment and Activation of the AP-1 Clathrin Adaptor Complex by Arf1.
18	PDB:6cesA	0.323	0.234	9.169E-3	300	0.035	0.023	6cesA.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
19	PDB:6jwpJ	0.292	0.385	9.169E-3	144	0.076	0.104	6jwpJ.pdb.gz	Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
20	PDB:2j3tD	0.314	0.297	1.483E-2	210	0.141	0.133	2j3tD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D2J0	2.01e-148	411	198	1.000	1.000	A4D2J0_HUMAN SNARE protein Ykt6 OS=Homo sapiens OX=9606 GN=YKT6 PE=1 SV=1
2	O15498	2.01e-148	411	198	1.000	1.000	YKT6_HUMAN Synaptobrevin homolog YKT6 OS=Homo sapiens OX=9606 GN=YKT6 PE=1 SV=1
3	Q5EGY4	9.17e-132	369	198	0.949	0.949	YKT6_RAT Synaptobrevin homolog YKT6 OS=Rattus norvegicus OX=10116 GN=Ykt6 PE=1 SV=1
4	O60073	2.83e-65	201	197	0.540	0.543	YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ykt6 PE=3 SV=1
5	P36015	1.45e-63	197	200	0.475	0.470	YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKT6 PE=1 SV=1
6	Q5AI79	2.29e-63	196	200	0.455	0.450	Q5AI79_CANAL Synaptobrevin homolog YKT6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YKT6 PE=3 SV=1
7	Q6FW27	3.35e-59	186	205	0.470	0.454	YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=YKT6 PE=3 SV=1
8	Q9ZRD6	7.05e-51	164	199	0.455	0.452	YKT61_ARATH VAMP-like protein YKT61 OS=Arabidopsis thaliana OX=3702 GN=YKT61 PE=1 SV=1
9	Q54ES8	1.29e-47	156	202	0.455	0.446	YKT6_DICDI Putative synaptobrevin homolog YKT6 OS=Dictyostelium discoideum OX=44689 GN=ykt6 PE=1 SV=1
10	Q38D47	1.10e-45	151	205	0.409	0.395	Q38D47_TRYB2 Vesicle-associated membrane protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4610 PE=3 SV=1
11	F4KDI1	8.55e-45	150	221	0.460	0.412	F4KDI1_ARATH SNARE-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=YKT61 PE=1 SV=1
12	Q9LVM9	2.89e-41	140	199	0.399	0.397	YKT62_ARATH VAMP-like protein YKT62 OS=Arabidopsis thaliana OX=3702 GN=YKT62 PE=1 SV=1
13	Q8I346	1.73e-17	78.6	199	0.227	0.226	Q8I346_PLAF7 SNARE protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0910600 PE=3 SV=1
14	Q86AQ7	6.88e-13	67.4	260	0.247	0.188	VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum OX=44689 GN=vamp7B PE=3 SV=1
15	Q7JYX5	3.99e-12	64.7	218	0.237	0.216	Q7JYX5_DROME RH15778p OS=Drosophila melanogaster OX=7227 GN=Vamp7 PE=1 SV=1
16	P70280	3.82e-09	56.6	220	0.207	0.186	VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus OX=10090 GN=Vamp7 PE=1 SV=1
17	Q9JHW5	4.09e-09	56.2	220	0.212	0.191	VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus OX=10116 GN=Vamp7 PE=1 SV=1
18	Q9SIQ9	1.44e-08	54.7	219	0.202	0.183	VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana OX=3702 GN=VAMP712 PE=2 SV=1
19	P51809	1.54e-08	54.7	220	0.202	0.182	VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens OX=9606 GN=VAMP7 PE=1 SV=3
20	B2R6P4	3.10e-08	53.9	220	0.202	0.182	B2R6P4_HUMAN cDNA, FLJ93048, highly similar to Homo sapiens synaptobrevin-like 1 (SYBL1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13774 Longin	7.6e-11	53.2	Regulated-SNARE-like domain
2	PF00957 Synaptobrevin	1.2e-10	52.3	Synaptobrevin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004462

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019222	0.998	Vesicle transport through interaction with t-SNAREs 1A
2	61853.ENSNLEP00000017727	0.994	Syntaxin 7
3	61853.ENSNLEP00000005123	0.993	Syntaxin 5
4	61853.ENSNLEP00000000944	0.992	Uncharacterized protein
5	61853.ENSNLEP00000004515	0.992	Golgi SNAP receptor complex member 1
6	61853.ENSNLEP00000012262	0.992	Syntaxin 8
7	61853.ENSNLEP00000006656	0.986	SEC22 vesicle trafficking protein homolog B (S. cerevisiae) (gene/pseudogene)
8	61853.ENSNLEP00000020725	0.976	Syntaxin 17
9	61853.ENSNLEP00000019437	0.968	Syntaxin 6
10	61853.ENSNLEP00000018740	0.967	Bet1 golgi vesicular membrane trafficking protein
11	61853.ENSNLEP00000022210	0.964	Uncharacterized protein
12	61853.ENSNLEP00000011409	0.962	Syntaxin 16
13	61853.ENSNLEP00000001832	0.961	Uncharacterized protein
14	61853.ENSNLEP00000005973	0.960	Uncharacterized protein
15	61853.ENSNLEP00000000119	0.958	Synaptosomal-associated protein, 29kDa
16	61853.ENSNLEP00000017581	0.958	Synaptosomal-associated protein, 25kDa
17	61853.ENSNLEP00000018891	0.957	Bet1 golgi vesicular membrane trafficking protein-like
18	61853.ENSNLEP00000006877	0.954	Unconventional SNARE in the ER 1 homolog (S. cerevisiae)
19	61853.ENSNLEP00000019558	0.951	Syntaxin 18
20	61853.ENSNLEP00000011769	0.947	Syntaxin 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005484	0.926	SNAP receptor activity
GO:0003824	0.604	catalytic activity
GO:0016409	0.561	palmitoyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051179	0.987	localization
GO:0006810	0.983	transport
GO:0051641	0.971	cellular localization
GO:0016192	0.949	vesicle-mediated transport
GO:0048193	0.927	Golgi vesicle transport
GO:0051649	0.916	establishment of localization in cell
GO:0046907	0.903	intracellular transport
GO:0006888	0.874	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006887	0.834	exocytosis
GO:0016482	0.716	cytosolic transport
GO:0051640	0.696	organelle localization
GO:0071840	0.658	cellular component organization or biogenesis
GO:0016043	0.646	cellular component organization
GO:0022406	0.620	membrane docking
GO:0140029	0.547	exocytic process
GO:0051648	0.538	vesicle localization
GO:0140056	0.516	organelle localization by membrane tethering
GO:0006996	0.420	organelle organization
GO:0016197	0.324	endosomal transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0016020	0.993	membrane
GO:0005829	0.984	cytosol
GO:0032991	0.978	protein-containing complex
GO:0031090	0.956	organelle membrane
GO:0031982	0.948	vesicle
GO:0098588	0.925	bounding membrane of organelle
GO:0005739	0.808	mitochondrion
GO:0005794	0.797	Golgi apparatus
GO:0031410	0.678	cytoplasmic vesicle
GO:0000139	0.659	Golgi membrane
GO:0098796	0.655	membrane protein complex
GO:0031201	0.486	SNARE complex
GO:0030133	0.398	transport vesicle
GO:0071944	0.346	cell periphery
GO:0005886	0.344	plasma membrane
GO:0005783	0.316	endoplasmic reticulum
GO:0005768	0.302	endosome
GO:0033116	0.300	endoplasmic reticulum-Golgi intermediate compartment membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.561	Transferring groups other than amino-acyl groups.

[back to server]