StarFunc result for job id O15519

User Input

>input (480 residues)
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT
SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP
EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15519	1.000	1.000	1.943E-90	480	1.000	1.000	O15519.pdb.gz	CFLAR_HUMAN CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1
2	AFDB:C0H5Y5	0.509	0.509	8.423E-65	480	0.677	0.677	C0H5Y5.pdb.gz	C0H5Y5_RAT CASP8 and FADD-like apoptosis regulator OS=Rattus norvegicus OX=10116 GN=Cflar PE=3 SV=1
3	AFDB:O35732	0.513	0.512	2.497E-64	481	0.658	0.657	O35732.pdb.gz	CFLAR_MOUSE CASP8 and FADD-like apoptosis regulator OS=Mus musculus OX=10090 GN=Cflar PE=1 SV=3
4	AFDB:Q14790	0.618	0.619	3.802E-30	479	0.275	0.276	Q14790.pdb.gz	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
5	AFDB:Q9JHX4	0.550	0.548	1.417E-29	482	0.275	0.274	Q9JHX4.pdb.gz	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
6	AFDB:O89110	0.510	0.510	1.682E-29	480	0.269	0.269	O89110.pdb.gz	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
7	AFDB:A0A2U9DQK9	0.383	0.385	9.223E-28	477	0.267	0.268	A0A2U9DQK9.pdb.gz
8	AFDB:Q92851	0.325	0.300	4.505E-22	521	0.252	0.232	Q92851.pdb.gz	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
9	AFDB:A0A288CG41	0.395	0.431	2.540E-18	437	0.183	0.201	A0A288CG41.pdb.gz	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
10	AFDB:P42575	0.386	0.409	7.531E-18	452	0.171	0.181	P42575.pdb.gz	CASP2_HUMAN Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2
11	PDB:4iyrB	0.347	0.830	2.120E-12	191	0.119	0.298	4iyrB.pdb.gz
12	PDB:4nblA	0.368	0.662	2.821E-12	258	0.131	0.244	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
13	PDB:4fdlB	0.382	0.743	3.976E-12	239	0.129	0.259	4fdlB.pdb.gz
14	PDB:4pryA	0.371	0.694	6.284E-12	249	0.127	0.245	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
15	PDB:2bbzA	0.329	0.801	3.862E-10	190	0.113	0.284	2bbzA.pdb.gz
16	PDB:5jqeA	0.327	0.289	8.603E-10	544	0.094	0.083	5jqeA.pdb.gz
17	PDB:2wdpD	0.333	0.653	1.021E-9	230	0.129	0.270	2wdpD.pdb.gz
18	PDB:7wzsB	0.349	0.781	3.028E-9	206	0.115	0.267	7wzsB.pdb.gz
19	PDB:4af8A	0.261	0.351	1.111E-3	333	0.081	0.117	4af8A.pdb.gz
20	PDB:7cqiT	0.158	0.153	3.640E-2	498	0.065	0.062	7cqiT.pdb.gz	Structural insights into the assembly and substrate selectivity of human SPT-ORMDL3 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C0H5Y5	0.0	634	480	0.681	0.681	C0H5Y5_RAT CASP8 and FADD-like apoptosis regulator OS=Rattus norvegicus OX=10116 GN=Cflar PE=3 SV=1
2	O15519	0.0	988	480	1.000	1.000	CFLAR_HUMAN CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1
3	O35732	0.0	630	481	0.671	0.669	CFLAR_MOUSE CASP8 and FADD-like apoptosis regulator OS=Mus musculus OX=10090 GN=Cflar PE=1 SV=3
4	Q99MZ5	2.43e-94	286	218	0.306	0.674	Q99MZ5_RAT CASP8 and FADD-like apoptosis regulator, isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Cflar PE=2 SV=1
5	Q9JHX4	1.79e-35	139	482	0.298	0.297	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
6	O89110	5.93e-34	135	480	0.294	0.294	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
7	Q14790	8.10e-33	132	479	0.292	0.292	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
8	Q66I19	1.15e-31	129	476	0.292	0.294	Q66I19_DANRE Caspase 8, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=zgc:92075 PE=1 SV=1
9	Q92851	1.42e-23	105	521	0.269	0.248	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
10	Q1XBR6	1.51e-21	94.0	182	0.121	0.319	Q1XBR6_BHV4 V-FLIP OS=Bovine herpesvirus 4 OX=10385 GN=ORF71 PE=4 SV=1
11	Q98325	3.36e-18	85.9	241	0.148	0.295	CFLA_MCV1 Viral CASP8 and FADD-like apoptosis regulator OS=Molluscum contagiosum virus subtype 1 OX=10280 GN=MC159L PE=1 SV=1
12	H7C0E2	3.03e-16	80.9	258	0.138	0.256	H7C0E2_HUMAN Caspase-8 (Fragment) OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
13	F1NV61	5.98e-16	80.9	309	0.129	0.201	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
14	O93417	7.27e-16	80.1	283	0.142	0.240	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
15	H0Z8H6	1.72e-15	79.0	282	0.144	0.245	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
16	P88961	7.60e-15	75.1	188	0.121	0.309	P88961_HHV8 ORF K13 OS=Human herpesvirus 8 type M OX=435895 PE=1 SV=2
17	A0A288CG41	1.86e-12	71.2	437	0.115	0.126	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
18	Q0PKX3	1.87e-12	71.2	435	0.115	0.126	Q0PKX3_DANRE Caspase 2, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
19	Q95ND5	2.09e-12	69.7	277	0.125	0.217	CASP3_PIG Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1
20	Q8MKI5	6.81e-12	68.2	277	0.123	0.213	CASP3_CANLF Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01335 DED	2e-30	116.0	Death effector domain
2	PF12840 HTH_20	4.2e+02	12.4	Helix-turn-helix domain
3	PF12802 MarR_2	3.6e+02	12.6	MarR family
4	PF00656 Peptidase_C14	1.1e-11	56.7	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312455

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301838	0.999	FAS-associated death domain protein
2	9606.ENSP00000259808	0.998	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000283290	0.998	Ubiquitin-like-conjugating enzyme ATG3
4	9606.ENSP00000351273	0.998	Caspase-8
5	9606.ENSP00000276431	0.996	Tumor necrosis factor receptor superfamily member 10B
6	9606.ENSP00000347979	0.996	Tumor necrosis factor receptor superfamily member 6
7	9606.ENSP00000286186	0.992	Caspase-10
8	9606.ENSP00000241261	0.989	Tumor necrosis factor ligand superfamily member 10
9	9606.ENSP00000352257	0.987	X-ray repair cross-complementing protein 6
10	9606.ENSP00000216274	0.986	Receptor-interacting serine/threonine-protein kinase 3
11	9606.ENSP00000221132	0.985	Tumor necrosis factor receptor superfamily member 10A
12	9606.ENSP00000477613	0.985	Baculoviral IAP repeat-containing protein 2
13	9606.ENSP00000480499	0.984	E3 ubiquitin-protein ligase Itchy homolog
14	9606.ENSP00000263464	0.983	Baculoviral IAP repeat-containing protein 3
15	9606.ENSP00000356694	0.981	Tumor necrosis factor ligand superfamily member 6
16	9606.ENSP00000341268	0.978	Tumor necrosis factor receptor type 1-associated DEATH domain protein
17	9606.ENSP00000362994	0.969	TNF receptor-associated factor 1
18	9606.ENSP00000220751	0.964	Receptor-interacting serine/threonine-protein kinase 2
19	9606.ENSP00000247668	0.961	TNF receptor-associated factor 2
20	9606.ENSP00000363668	0.961	Death domain-associated protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008047	0.998	enzyme activator activity
GO:0002020	0.998	protease binding
GO:0140096	0.952	catalytic activity, acting on a protein
GO:0008233	0.645	peptidase activity
GO:0008234	0.603	cysteine-type peptidase activity
GO:0004197	0.508	cysteine-type endopeptidase activity
GO:0042802	0.409	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0010941	0.995	regulation of cell death
GO:0048522	0.990	positive regulation of cellular process
GO:1902531	0.990	regulation of intracellular signal transduction
GO:0048519	0.989	negative regulation of biological process
GO:0042981	0.987	regulation of apoptotic process
GO:0048523	0.984	negative regulation of cellular process
GO:0048584	0.983	positive regulation of response to stimulus
GO:0023056	0.949	positive regulation of signaling
GO:0010647	0.949	positive regulation of cell communication
GO:0006915	0.947	apoptotic process
GO:0043066	0.946	negative regulation of apoptotic process
GO:1902533	0.935	positive regulation of intracellular signal transduction
GO:0019222	0.930	regulation of metabolic process
GO:0050896	0.927	response to stimulus
GO:0043122	0.887	regulation of I-kappaB kinase/NF-kappaB signaling
GO:2001236	0.887	regulation of extrinsic apoptotic signaling pathway
GO:0048585	0.869	negative regulation of response to stimulus
GO:0043123	0.865	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051716	0.856	cellular response to stimulus
GO:0060255	0.843	regulation of macromolecule metabolic process
GO:2001234	0.822	negative regulation of apoptotic signaling pathway
GO:0080090	0.810	regulation of primary metabolic process
GO:0051171	0.810	regulation of nitrogen compound metabolic process
GO:2001237	0.782	negative regulation of extrinsic apoptotic signaling pathway
GO:0010939	0.759	regulation of necrotic cell death
GO:0031323	0.730	regulation of cellular metabolic process
GO:0007154	0.659	cell communication
GO:0007165	0.639	signal transduction
GO:1902041	0.625	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0065009	0.568	regulation of molecular function
GO:0010468	0.557	regulation of gene expression
GO:0042221	0.518	response to chemical
GO:0051246	0.517	regulation of protein metabolic process
GO:0009889	0.490	regulation of biosynthetic process
GO:0019219	0.440	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.439	regulation of macromolecule biosynthetic process
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0006355	0.428	regulation of DNA-templated transcription
GO:0070887	0.405	cellular response to chemical stimulus
GO:0010033	0.403	response to organic substance
GO:0006950	0.401	response to stress
GO:0050790	0.401	regulation of catalytic activity
GO:0052548	0.369	regulation of endopeptidase activity
GO:0044093	0.360	positive regulation of molecular function
GO:0008152	0.359	metabolic process
GO:0071310	0.357	cellular response to organic substance
GO:0009893	0.340	positive regulation of metabolic process
GO:0010942	0.339	positive regulation of cell death
GO:0009605	0.337	response to external stimulus
GO:0071704	0.313	organic substance metabolic process
GO:0051128	0.302	regulation of cellular component organization
GO:0043068	0.302	positive regulation of programmed cell death
GO:0009892	0.301	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0098796	0.973	membrane protein complex
GO:0098797	0.957	plasma membrane protein complex
GO:1902494	0.943	catalytic complex
GO:0043231	0.842	intracellular membrane-bounded organelle
GO:0005634	0.795	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.645	Acting on peptide bonds (peptidases).
EC:3.4.22.-	0.508	Cysteine endopeptidases.

[back to server]