StarFunc result for job id O15520

User Input

>input (208 residues)
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP
SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV
VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL
NGKGAPRRGQKTRRKNTSAHFLPMVVHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70492	0.737	0.714	2.746E-35	215	0.995	0.963	P70492.pdb.gz	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
2	AFDB:O42407	0.700	0.687	6.857E-32	212	0.870	0.854	O42407.pdb.gz	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
3	AFDB:Q4VBV7	0.709	0.733	1.218E-24	201	0.548	0.567	Q4VBV7.pdb.gz
4	AFDB:Q1XG76	0.687	0.690	3.320E-23	207	0.500	0.502	Q1XG76.pdb.gz	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
5	AFDB:A0A0R4ITI2	0.626	0.682	1.274E-20	191	0.466	0.508	A0A0R4ITI2.pdb.gz
6	AFDB:Q9HCT0	0.691	0.843	1.274E-20	170	0.385	0.471	Q9HCT0.pdb.gz	FGF22_HUMAN Fibroblast growth factor 22 OS=Homo sapiens OX=9606 GN=FGF22 PE=1 SV=1
7	AFDB:P21781	0.632	0.677	1.346E-20	194	0.385	0.412	P21781.pdb.gz	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
8	AFDB:Q9ESS2	0.671	0.860	2.467E-20	162	0.361	0.463	Q9ESS2.pdb.gz	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
9	AFDB:P48802	0.628	0.511	2.696E-17	256	0.389	0.316	P48802.pdb.gz	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
10	AFDB:P31371	0.622	0.622	4.427E-17	208	0.332	0.332	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
11	PDB:3f1rA	0.613	0.808	3.855E-14	157	0.264	0.350	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.604	0.881	1.726E-12	141	0.216	0.319	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.585	0.798	4.452E-11	151	0.216	0.298	1ry7A.pdb.gz
14	PDB:4qd2B	0.531	0.746	6.272E-5	143	0.062	0.091	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
15	PDB:6b0tA	0.505	0.226	6.628E-5	487	0.087	0.037	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
16	PDB:3malA	0.435	0.493	4.558E-4	181	0.125	0.144	3malA.pdb.gz
17	PDB:7t3qA	0.438	0.053	9.328E-4	2103	0.115	0.011	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:7vmlA	0.475	0.029	1.298E-3	4044	0.072	0.004	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
19	PDB:1t9fA	0.379	0.437	1.532E-3	178	0.072	0.084	1t9fA.pdb.gz
20	PDB:1hcdA	0.456	0.744	1.807E-3	118	0.087	0.153	1hcdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15520	7.21e-158	436	208	1.000	1.000	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
2	P70492	1.25e-152	423	215	0.995	0.963	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
3	O35565	7.74e-127	358	209	0.928	0.923	FGF10_MOUSE Fibroblast growth factor 10 OS=Mus musculus OX=10090 GN=Fgf10 PE=2 SV=1
4	O42407	2.05e-110	316	212	0.856	0.840	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
5	Q8AY90	2.43e-70	214	201	0.486	0.502	Q8AY90_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf10 PE=2 SV=1
6	Q1XG75	8.25e-67	205	187	0.447	0.497	Q1XG75_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf10b PE=2 SV=1
7	Q1XG76	9.10e-67	206	207	0.505	0.507	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
8	P21781	7.21e-58	182	194	0.462	0.495	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
9	Q9ESS2	3.67e-56	177	162	0.361	0.463	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
10	P36363	4.97e-55	175	194	0.476	0.510	FGF7_MOUSE Fibroblast growth factor 7 OS=Mus musculus OX=10090 GN=Fgf7 PE=2 SV=1
11	Q02195	8.42e-54	172	194	0.471	0.505	FGF7_RAT Fibroblast growth factor 7 OS=Rattus norvegicus OX=10116 GN=Fgf7 PE=1 SV=1
12	Q9HCT0	1.07e-48	158	170	0.380	0.465	FGF22_HUMAN Fibroblast growth factor 22 OS=Homo sapiens OX=9606 GN=FGF22 PE=1 SV=1
13	P48802	2.47e-41	142	256	0.365	0.297	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
14	P05524	6.05e-40	138	245	0.361	0.306	FGF3_MOUSE Fibroblast growth factor 3 OS=Mus musculus OX=10090 GN=Fgf3 PE=1 SV=3
15	P11487	2.16e-38	134	239	0.346	0.301	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
16	Q60GK9	2.63e-38	130	112	0.423	0.786	Q60GK9_CHICK Fibroblast growth factor 10 (Fragment) OS=Gallus gallus OX=9031 GN=FGF10 PE=3 SV=1
17	P36364	7.07e-38	132	208	0.298	0.298	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
18	P54130	7.07e-38	132	208	0.298	0.298	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
19	P31371	8.77e-38	132	208	0.298	0.298	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
20	O43320	1.38e-36	129	207	0.288	0.290	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	1.8	20.3	Fascin domain
2	PF00167 FGF	3.2e-45	164.6	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410294	0.999	Fibroblast growth factor receptor 2
2	9606.ENSP00000393312	0.982	Fibroblast growth factor receptor 1
3	9606.ENSP00000365687	0.944	Pancreas transcription factor 1 subunit alpha
4	9606.ENSP00000407586	0.937	GTPase HRas
5	9606.ENSP00000263025	0.933	Mitogen-activated protein kinase 3
6	9606.ENSP00000370421	0.933	Pancreas/duodenum homeobox protein 1
7	9606.ENSP00000256078	0.927	GTPase KRas
8	9606.ENSP00000215832	0.914	Mitogen-activated protein kinase 1
9	9606.ENSP00000358548	0.907	GTPase NRas
10	9606.ENSP00000339824	0.899	Fibroblast growth factor receptor 3
11	9606.ENSP00000240335	0.895	T-box transcription factor TBX4
12	9606.ENSP00000309913	0.894	T-box transcription factor TBX5
13	9606.ENSP00000297261	0.875	Sonic hedgehog protein
14	9606.ENSP00000292408	0.872	Fibroblast growth factor receptor 4
15	9606.ENSP00000265171	0.836	Pro-epidermal growth factor
16	9606.ENSP00000263923	0.834	Vascular endothelial growth factor receptor 2
17	9606.ENSP00000245451	0.830	Bone morphogenetic protein 4
18	9606.ENSP00000381498	0.786	Fibroblast growth factor receptor-like 1
19	9606.ENSP00000257290	0.775	Platelet-derived growth factor receptor alpha
20	9606.ENSP00000275493	0.773	Epidermal growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042056	1.000	chemoattractant activity
GO:0070851	0.998	growth factor receptor binding
GO:0008083	0.992	growth factor activity
GO:0005104	0.990	fibroblast growth factor receptor binding
GO:0097367	0.747	carbohydrate derivative binding
GO:1901681	0.731	sulfur compound binding
GO:0005539	0.585	glycosaminoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.990	cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0035295	0.986	tube development
GO:0009653	0.985	anatomical structure morphogenesis
GO:0048646	0.984	anatomical structure formation involved in morphogenesis
GO:0010646	0.979	regulation of cell communication
GO:0048584	0.979	positive regulation of response to stimulus
GO:0023051	0.978	regulation of signaling
GO:0007165	0.975	signal transduction
GO:0071774	0.967	response to fibroblast growth factor
GO:0048513	0.964	animal organ development
GO:0071363	0.961	cellular response to growth factor stimulus
GO:0048731	0.961	system development
GO:0007169	0.959	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051239	0.950	regulation of multicellular organismal process
GO:0035239	0.950	tube morphogenesis
GO:0044344	0.948	cellular response to fibroblast growth factor stimulus
GO:0008283	0.947	cell population proliferation
GO:0042127	0.942	regulation of cell population proliferation
GO:0009967	0.938	positive regulation of signal transduction
GO:0009888	0.934	tissue development
GO:0008284	0.917	positive regulation of cell population proliferation
GO:0030335	0.909	positive regulation of cell migration
GO:0019219	0.907	regulation of nucleobase-containing compound metabolic process
GO:0050678	0.906	regulation of epithelial cell proliferation
GO:0043408	0.897	regulation of MAPK cascade
GO:0050679	0.889	positive regulation of epithelial cell proliferation
GO:0042221	0.867	response to chemical
GO:0010634	0.863	positive regulation of epithelial cell migration
GO:0060255	0.850	regulation of macromolecule metabolic process
GO:0010604	0.842	positive regulation of macromolecule metabolic process
GO:0035108	0.829	limb morphogenesis
GO:0031325	0.829	positive regulation of cellular metabolic process
GO:0051173	0.799	positive regulation of nitrogen compound metabolic process
GO:0030324	0.795	lung development
GO:1902533	0.790	positive regulation of intracellular signal transduction
GO:0050793	0.781	regulation of developmental process
GO:0048519	0.766	negative regulation of biological process
GO:0008543	0.758	fibroblast growth factor receptor signaling pathway
GO:0022603	0.751	regulation of anatomical structure morphogenesis
GO:0007399	0.733	nervous system development
GO:0010468	0.726	regulation of gene expression
GO:0061138	0.708	morphogenesis of a branching epithelium
GO:0009887	0.706	animal organ morphogenesis
GO:0090287	0.701	regulation of cellular response to growth factor stimulus
GO:0060828	0.672	regulation of canonical Wnt signaling pathway
GO:0060443	0.667	mammary gland morphogenesis
GO:0009605	0.654	response to external stimulus
GO:2000027	0.646	regulation of animal organ morphogenesis
GO:0009790	0.644	embryo development
GO:0048523	0.625	negative regulation of cellular process
GO:0030177	0.617	positive regulation of Wnt signaling pathway
GO:0090263	0.610	positive regulation of canonical Wnt signaling pathway
GO:0050673	0.599	epithelial cell proliferation
GO:0060425	0.586	lung morphogenesis
GO:0003002	0.576	regionalization
GO:0051252	0.572	regulation of RNA metabolic process
GO:0045935	0.534	positive regulation of nucleobase-containing compound metabolic process
GO:0051094	0.524	positive regulation of developmental process
GO:0048598	0.514	embryonic morphogenesis
GO:0060562	0.514	epithelial tube morphogenesis
GO:0009889	0.508	regulation of biosynthetic process
GO:0051246	0.495	regulation of protein metabolic process
GO:0048869	0.494	cellular developmental process
GO:0010556	0.494	regulation of macromolecule biosynthetic process
GO:0031326	0.494	regulation of cellular biosynthetic process
GO:0006355	0.474	regulation of DNA-templated transcription
GO:0010557	0.464	positive regulation of macromolecule biosynthetic process
GO:0031328	0.458	positive regulation of cellular biosynthetic process
GO:0051254	0.455	positive regulation of RNA metabolic process
GO:0065009	0.452	regulation of molecular function
GO:1902680	0.448	positive regulation of RNA biosynthetic process
GO:1903508	0.443	positive regulation of nucleic acid-templated transcription
GO:0043410	0.438	positive regulation of MAPK cascade
GO:0030154	0.437	cell differentiation
GO:0045893	0.422	positive regulation of DNA-templated transcription
GO:0010033	0.402	response to organic substance
GO:0048589	0.353	developmental growth
GO:0042325	0.353	regulation of phosphorylation
GO:0008152	0.345	metabolic process
GO:0006357	0.333	regulation of transcription by RNA polymerase II
GO:0051247	0.328	positive regulation of protein metabolic process
GO:0042327	0.317	positive regulation of phosphorylation
GO:0071704	0.311	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.979	extracellular space
GO:0043227	0.962	membrane-bounded organelle
GO:0071944	0.951	cell periphery
GO:0016020	0.916	membrane
GO:0043229	0.916	intracellular organelle
GO:0043231	0.900	intracellular membrane-bounded organelle
GO:0005886	0.815	plasma membrane
GO:0005737	0.710	cytoplasm
GO:0005634	0.576	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]