StarFunc result for job id O15522

User Input

>input (239 residues)
MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLE
TSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASL
LRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQP
CGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15522	0.999	0.999	1.381E-36	239	1.000	1.000	O15522.pdb.gz	NKX28_HUMAN Homeobox protein Nkx-2.8 OS=Homo sapiens OX=9606 GN=NKX2-8 PE=2 SV=2
2	AFDB:O70584	0.403	0.410	1.490E-22	235	0.753	0.766	O70584.pdb.gz	NKX28_MOUSE Homeobox protein Nkx-2.8 OS=Mus musculus OX=10090 GN=Nkx2-8 PE=2 SV=2
3	AFDB:Q06AD2	0.396	0.550	1.059E-14	164	0.439	0.640	Q06AD2.pdb.gz
4	AFDB:Q90481	0.342	0.309	4.989E-12	269	0.448	0.398	Q90481.pdb.gz	NX22A_DANRE Homeobox protein Nkx-2.2a OS=Danio rerio OX=7955 GN=nkx2.2a PE=2 SV=1
5	AFDB:D3ZDQ2	0.312	0.275	2.817E-11	273	0.444	0.388	D3ZDQ2.pdb.gz	D3ZDQ2_RAT NK2 homeobox 2 OS=Rattus norvegicus OX=10116 GN=Nkx2-2 PE=4 SV=1
6	AFDB:Q8BRS9	0.276	0.267	6.114E-10	248	0.351	0.339	Q8BRS9.pdb.gz	Q8BRS9_MOUSE NK2 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=1
7	AFDB:P23441	0.262	0.175	1.021E-9	372	0.423	0.272	P23441.pdb.gz	NKX21_RAT Homeobox protein Nkx-2.1 OS=Rattus norvegicus OX=10116 GN=Nkx2-1 PE=1 SV=1
8	AFDB:A6NCS4	0.280	0.225	3.238E-9	301	0.423	0.336	A6NCS4.pdb.gz	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
9	AFDB:Q8TAU0	0.243	0.162	3.238E-9	364	0.402	0.264	Q8TAU0.pdb.gz	NKX23_HUMAN Homeobox protein Nkx-2.3 OS=Homo sapiens OX=9606 GN=NKX2-3 PE=2 SV=2
10	AFDB:A5WVY6	0.275	0.219	3.681E-9	307	0.360	0.280	A5WVY6.pdb.gz
11	PDB:4egcA	0.204	0.091	1.436E-2	539	0.067	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.202	0.604	1.989E-1	73	0.059	0.192	2hi3A.pdb.gz
13	PDB:5aj0BZ	0.172	0.415	1.198	86	0.050	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
14	PDB:7fbyA	0.163	0.239	1.548	153	0.033	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5z56L	0.170	0.124	2.000	342	0.038	0.026	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:7awtE	0.113	0.161	3.133	156	0.029	0.045	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
17	PDB:7b93E	0.131	0.144	3.133	215	0.038	0.042	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
18	PDB:7nac7	0.098	0.157	4.317	129	0.088	0.163	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:2cjjA	0.207	0.698	4.603	63	0.038	0.143	2cjjA.pdb.gz
20	PDB:3femA	0.138	0.119	4.908	281	0.033	0.028	3femA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15522	3.06e-172	475	239	1.000	1.000	NKX28_HUMAN Homeobox protein Nkx-2.8 OS=Homo sapiens OX=9606 GN=NKX2-8 PE=2 SV=2
2	D4A7B5	4.25e-111	320	234	0.766	0.782	D4A7B5_RAT NK2 homeobox 8 OS=Rattus norvegicus OX=10116 GN=Nkx2-8 PE=4 SV=1
3	O70584	6.31e-108	312	235	0.757	0.770	NKX28_MOUSE Homeobox protein Nkx-2.8 OS=Mus musculus OX=10090 GN=Nkx2-8 PE=2 SV=2
4	Q90481	1.66e-46	157	269	0.427	0.379	NX22A_DANRE Homeobox protein Nkx-2.2a OS=Danio rerio OX=7955 GN=nkx2.2a PE=2 SV=1
5	Q5BJA8	2.29e-44	150	237	0.444	0.447	Q5BJA8_DANRE Homeobox protein Nkx-2.2 OS=Danio rerio OX=7955 GN=nkx2.2b PE=2 SV=1
6	O95096	2.58e-43	149	273	0.431	0.377	NKX22_HUMAN Homeobox protein Nkx-2.2 OS=Homo sapiens OX=9606 GN=NKX2-2 PE=2 SV=1
7	P42586	9.26e-43	147	273	0.439	0.385	NKX22_MOUSE Homeobox protein Nkx-2.2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=2
8	D3ZDQ2	9.46e-43	147	273	0.435	0.381	D3ZDQ2_RAT NK2 homeobox 2 OS=Rattus norvegicus OX=10116 GN=Nkx2-2 PE=4 SV=1
9	Q9YHB7	4.59e-41	141	219	0.377	0.411	Q9YHB7_CHICK Homeodomain protein (Fragment) OS=Gallus gallus OX=9031 GN=Nkx-2.2 PE=2 SV=1
10	Q9I8L7	7.05e-37	133	307	0.285	0.221	Q9I8L7_DANRE Homeobox protein OS=Danio rerio OX=7955 GN=nk2.1a PE=2 SV=1
11	P22808	1.85e-36	137	723	0.314	0.104	VND_DROME Homeobox protein vnd OS=Drosophila melanogaster OX=7227 GN=vnd PE=1 SV=3
12	Q8BRS9	6.52e-36	129	248	0.360	0.347	Q8BRS9_MOUSE NK2 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=1
13	B3DG22	8.86e-36	131	336	0.268	0.190	B3DG22_DANRE Homeobox protein Nkx-2.4 isoform 2 OS=Danio rerio OX=7955 GN=LOC100148014 PE=2 SV=1
14	Q58A07	1.24e-35	130	339	0.264	0.186	Q58A07_ONCMY Transcription factor Nkx2-4a OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4a PE=2 SV=1
15	A8KB41	1.58e-35	130	345	0.268	0.186	A8KB41_DANRE Homeobox protein Nkx-2.4 isoform 1 OS=Danio rerio OX=7955 GN=fi48a12 PE=2 SV=1
16	A8Y527	1.61e-35	130	307	0.276	0.215	A8Y527_DROME Scarecrow, isoform F OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=2
17	Q9NCG1	5.01e-35	130	380	0.276	0.174	Q9NCG1_DROME Homeobox protein Scarecrow (Fragment) OS=Drosophila melanogaster OX=7227 GN=scro PE=2 SV=1
18	Q7PL95	5.10e-35	131	468	0.276	0.141	Q7PL95_DROME Scarecrow, isoform A OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=1
19	Q98TX4	7.34e-35	129	346	0.259	0.179	Q98TX4_DANRE Homeobox protein Nkx-2.1 OS=Danio rerio OX=7955 GN=nk2.1b PE=2 SV=1
20	Q58A09	9.88e-35	128	344	0.259	0.180	Q58A09_ONCMY Transcription factor Nkx2-4c OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4c PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	71	14.8	Homeobox KN domain
2	PF00046 Homeodomain	3.5e-16	70.1	Homeodomain
3	PF06505 XylR_N	2.7e+02	12.7	Activator of aromatic catabolism

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351524	0.811	Probable helicase with zinc finger domain
2	9606.ENSP00000355245	0.800	Paired box protein Pax-9
3	9606.ENSP00000419184	0.771	Histone-lysine N-methyltransferase SMYD3
4	9606.ENSP00000282549	0.693	Homeobox protein OTX1
5	9606.ENSP00000265340	0.677	Pituitary homeobox 1
6	9606.ENSP00000355249	0.666	Transcription factor E2F2
7	9606.ENSP00000347672	0.661	VANGL planar cell polarity protein 1
8	9606.ENSP00000358983	0.656	Nuclear factor NF-kappa-B p100 subunit
9	9606.ENSP00000343819	0.572	Homeobox protein OTX2
10	9606.ENSP00000384524	0.549	ETS translocation variant 2
11	9606.ENSP00000292782	0.515	DCN1-like protein 1
12	9606.ENSP00000429553	0.515	Homeobox protein Nkx-6.3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.982	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0005515	0.975	protein binding
GO:0000978	0.975	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.976	regulation of metabolic process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0009987	0.946	cellular process
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0010468	0.926	regulation of gene expression
GO:0080090	0.925	regulation of primary metabolic process
GO:0019219	0.922	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.921	regulation of biosynthetic process
GO:0010604	0.900	positive regulation of macromolecule metabolic process
GO:0010557	0.885	positive regulation of macromolecule biosynthetic process
GO:0031328	0.884	positive regulation of cellular biosynthetic process
GO:0006357	0.812	regulation of transcription by RNA polymerase II
GO:0071704	0.777	organic substance metabolic process
GO:0045935	0.770	positive regulation of nucleobase-containing compound metabolic process
GO:0044238	0.732	primary metabolic process
GO:0044237	0.708	cellular metabolic process
GO:0006807	0.701	nitrogen compound metabolic process
GO:0045893	0.636	positive regulation of DNA-templated transcription
GO:0034641	0.633	cellular nitrogen compound metabolic process
GO:0006725	0.629	cellular aromatic compound metabolic process
GO:0018130	0.619	heterocycle biosynthetic process
GO:0034654	0.607	nucleobase-containing compound biosynthetic process
GO:0043170	0.590	macromolecule metabolic process
GO:0016070	0.548	RNA metabolic process
GO:0010467	0.491	gene expression
GO:0048519	0.486	negative regulation of biological process
GO:0045944	0.467	positive regulation of transcription by RNA polymerase II
GO:0009059	0.464	macromolecule biosynthetic process
GO:0006351	0.453	DNA-templated transcription
GO:0006366	0.354	transcription by RNA polymerase II
GO:0048523	0.338	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.932	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]