StarFunc result for job id O15524

User Input

>input (211 residues)
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35716	0.843	0.839	3.003E-39	212	0.957	0.953	O35716.pdb.gz	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
2	AFDB:V9Q5U6	0.742	0.694	7.728E-24	226	0.441	0.412	V9Q5U6.pdb.gz	V9Q5U6_SALSA Suppressor of cytokine signaling 1 OS=Salmo salar OX=8030 GN=SOCS1 PE=2 SV=1
3	AFDB:Q6DEF9	0.755	0.792	1.121E-23	201	0.398	0.418	Q6DEF9.pdb.gz	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
4	AFDB:B5XCB4	0.670	0.630	2.875E-16	225	0.265	0.249	B5XCB4.pdb.gz	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
5	AFDB:O14508	0.645	0.686	3.685E-16	198	0.303	0.323	O14508.pdb.gz	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
6	AFDB:Q08BW5	0.667	0.664	1.535E-15	212	0.284	0.283	Q08BW5.pdb.gz	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
7	AFDB:V9Q4K1	0.651	0.686	4.688E-15	200	0.270	0.285	V9Q4K1.pdb.gz	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
8	AFDB:L0N8K9	0.637	0.649	5.648E-15	207	0.308	0.314	L0N8K9.pdb.gz
9	AFDB:O14543	0.639	0.602	1.265E-14	225	0.280	0.262	O14543.pdb.gz	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
10	AFDB:Q9NSE2	0.660	0.543	2.503E-14	258	0.303	0.248	Q9NSE2.pdb.gz	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
11	PDB:8dcxB	0.374	0.338	7.423E-7	236	0.133	0.119	8dcxB.pdb.gz
12	PDB:4fl2A	0.381	0.152	6.510E-6	555	0.118	0.045	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:3ps5A	0.376	0.156	7.841E-6	529	0.175	0.070	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:7myoB	0.371	0.281	1.988E-5	286	0.123	0.091	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
15	PDB:4gwfA	0.380	0.169	3.266E-5	497	0.152	0.064	4gwfA.pdb.gz
16	PDB:1k9aB	0.360	0.180	4.739E-5	441	0.109	0.052	1k9aB.pdb.gz
17	PDB:5xzrA	0.368	0.161	5.365E-5	519	0.156	0.064	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
18	PDB:1ka6A	0.366	0.681	6.462E-5	107	0.104	0.206	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
19	PDB:4k2rA	0.412	0.165	7.784E-5	551	0.137	0.053	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
20	PDB:1griA	0.357	0.357	8.283E-5	211	0.104	0.104	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15524	4.16e-153	424	211	1.000	1.000	SOCS1_HUMAN Suppressor of cytokine signaling 1 OS=Homo sapiens OX=9606 GN=SOCS1 PE=1 SV=1
2	Q4JHT5	4.16e-153	424	211	1.000	1.000	Q4JHT5_HUMAN Suppressor of cytokine signaling 1 OS=Homo sapiens OX=9606 GN=SOCS1 PE=2 SV=1
3	O35716	1.57e-121	345	212	0.953	0.948	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
4	Q9QX78	1.77e-117	334	212	0.891	0.887	SOCS1_RAT Suppressor of cytokine signaling 1 OS=Rattus norvegicus OX=10116 GN=Socs1 PE=3 SV=1
5	Q6DEF9	7.77e-56	177	201	0.412	0.433	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
6	V9Q5U6	7.63e-49	160	226	0.365	0.341	V9Q5U6_SALSA Suppressor of cytokine signaling 1 OS=Salmo salar OX=8030 GN=SOCS1 PE=2 SV=1
7	O14508	8.33e-24	95.5	198	0.270	0.288	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
8	O88582	1.51e-23	95.1	198	0.265	0.283	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
9	O35717	1.81e-23	94.7	198	0.265	0.283	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
10	V9Q4K1	1.06e-20	87.4	200	0.280	0.295	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
11	V9Q6E2	1.83e-20	87.0	200	0.265	0.280	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1
12	Q7ZUC6	2.08e-20	87.0	207	0.275	0.280	Q7ZUC6_DANRE Suppressor of cytokine signaling 3 OS=Danio rerio OX=7955 GN=fj09e12 PE=2 SV=1
13	O14543	3.50e-20	86.7	225	0.242	0.227	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
14	O35718	4.59e-20	86.7	225	0.227	0.213	SOCS3_MOUSE Suppressor of cytokine signaling 3 OS=Mus musculus OX=10090 GN=Socs3 PE=1 SV=1
15	O88583	1.43e-19	85.1	225	0.237	0.222	SOCS3_RAT Suppressor of cytokine signaling 3 OS=Rattus norvegicus OX=10116 GN=Socs3 PE=1 SV=1
16	Q08BW5	3.27e-19	84.0	212	0.280	0.278	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
17	Q9NSE2	3.97e-16	76.6	258	0.284	0.233	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
18	Q62225	6.39e-16	75.9	257	0.308	0.253	CISH_MOUSE Cytokine-inducible SH2-containing protein OS=Mus musculus OX=10090 GN=Cish PE=1 SV=1
19	B9EPA9	8.28e-16	75.1	225	0.270	0.253	B9EPA9_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
20	B5XCB4	2.11e-15	73.9	225	0.246	0.231	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	3.6e-06	38.3	SH2 domain
2	PF07525 SOCS_box	0.29	22.8	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
2	9606.ENSP00000431885	0.998	Non-receptor tyrosine-protein kinase TYK2
3	9606.ENSP00000262306	0.996	Elongin-B
4	9606.ENSP00000356713	0.994	Interferon gamma receptor 1
5	9606.ENSP00000472929	0.993	Proto-oncogene vav
6	9606.ENSP00000343204	0.992	Tyrosine-protein kinase JAK1
7	9606.ENSP00000304895	0.991	Insulin receptor substrate 1
8	9606.ENSP00000376345	0.990	Growth factor receptor-bound protein 2
9	9606.ENSP00000478121	0.990	Elongin-C
10	9606.ENSP00000269305	0.987	Cellular tumor antigen p53
11	9606.ENSP00000391676	0.986	Tyrosine-protein kinase JAK3
12	9606.ENSP00000376808	0.974	Cullin-5
13	9606.ENSP00000341208	0.973	Signal transducer and activator of transcription 5A
14	9606.ENSP00000293328	0.972	Signal transducer and activator of transcription 5B
15	9606.ENSP00000300134	0.970	Signal transducer and activator of transcription 6
16	9606.ENSP00000288135	0.969	Mast/stem cell growth factor receptor Kit
17	9606.ENSP00000216223	0.960	Interleukin-2 receptor subunit beta
18	9606.ENSP00000229135	0.959	Interferon gamma
19	9606.ENSP00000231449	0.959	Interleukin-4
20	9606.ENSP00000226730	0.958	Interleukin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019210	1.000	kinase inhibitor activity
GO:0005102	0.677	signaling receptor binding
GO:0019899	0.532	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048519	0.990	negative regulation of biological process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0048522	0.989	positive regulation of cellular process
GO:0048583	0.988	regulation of response to stimulus
GO:0080090	0.988	regulation of primary metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0051716	0.986	cellular response to stimulus
GO:0002682	0.983	regulation of immune system process
GO:0048523	0.982	negative regulation of cellular process
GO:0042221	0.981	response to chemical
GO:0009966	0.981	regulation of signal transduction
GO:0051239	0.978	regulation of multicellular organismal process
GO:0001932	0.978	regulation of protein phosphorylation
GO:0050793	0.973	regulation of developmental process
GO:0002684	0.955	positive regulation of immune system process
GO:0050730	0.955	regulation of peptidyl-tyrosine phosphorylation
GO:0048856	0.954	anatomical structure development
GO:0010033	0.949	response to organic substance
GO:0048585	0.925	negative regulation of response to stimulus
GO:0045595	0.916	regulation of cell differentiation
GO:0051249	0.908	regulation of lymphocyte activation
GO:0030155	0.895	regulation of cell adhesion
GO:0022407	0.891	regulation of cell-cell adhesion
GO:0010605	0.887	negative regulation of macromolecule metabolic process
GO:0007154	0.881	cell communication
GO:0007165	0.870	signal transduction
GO:0022409	0.856	positive regulation of cell-cell adhesion
GO:1903706	0.856	regulation of hemopoiesis
GO:0051251	0.855	positive regulation of lymphocyte activation
GO:1903037	0.851	regulation of leukocyte cell-cell adhesion
GO:0050863	0.849	regulation of T cell activation
GO:0045597	0.845	positive regulation of cell differentiation
GO:0031324	0.839	negative regulation of cellular metabolic process
GO:0023057	0.838	negative regulation of signaling
GO:0010648	0.838	negative regulation of cell communication
GO:1903039	0.827	positive regulation of leukocyte cell-cell adhesion
GO:1904892	0.825	regulation of receptor signaling pathway via STAT
GO:0031400	0.823	negative regulation of protein modification process
GO:0009968	0.821	negative regulation of signal transduction
GO:0046425	0.812	regulation of receptor signaling pathway via JAK-STAT
GO:0048869	0.807	cellular developmental process
GO:0042509	0.801	regulation of tyrosine phosphorylation of STAT protein
GO:0042326	0.785	negative regulation of phosphorylation
GO:0001933	0.783	negative regulation of protein phosphorylation
GO:0070887	0.774	cellular response to chemical stimulus
GO:1902105	0.764	regulation of leukocyte differentiation
GO:0050870	0.750	positive regulation of T cell activation
GO:0071310	0.744	cellular response to organic substance
GO:0030154	0.719	cell differentiation
GO:0007166	0.719	cell surface receptor signaling pathway
GO:0010468	0.718	regulation of gene expression
GO:0009893	0.713	positive regulation of metabolic process
GO:0045619	0.703	regulation of lymphocyte differentiation
GO:1902107	0.703	positive regulation of leukocyte differentiation
GO:0010604	0.693	positive regulation of macromolecule metabolic process
GO:0071345	0.692	cellular response to cytokine stimulus
GO:1904893	0.691	negative regulation of receptor signaling pathway via STAT
GO:0046426	0.667	negative regulation of receptor signaling pathway via JAK-STAT
GO:0045621	0.621	positive regulation of lymphocyte differentiation
GO:0045580	0.616	regulation of T cell differentiation
GO:0050732	0.531	negative regulation of peptidyl-tyrosine phosphorylation
GO:0045582	0.517	positive regulation of T cell differentiation
GO:1901700	0.509	response to oxygen-containing compound
GO:0006950	0.493	response to stress
GO:0002376	0.491	immune system process
GO:0031325	0.479	positive regulation of cellular metabolic process
GO:0009719	0.478	response to endogenous stimulus
GO:0009605	0.476	response to external stimulus
GO:0044419	0.460	biological process involved in interspecies interaction between organisms
GO:0065009	0.450	regulation of molecular function
GO:0008152	0.440	metabolic process
GO:0009607	0.436	response to biotic stimulus
GO:0032501	0.430	multicellular organismal process
GO:0044237	0.430	cellular metabolic process
GO:0042127	0.423	regulation of cell population proliferation
GO:0048584	0.416	positive regulation of response to stimulus
GO:0071495	0.403	cellular response to endogenous stimulus
GO:0001817	0.366	regulation of cytokine production
GO:0051173	0.363	positive regulation of nitrogen compound metabolic process
GO:1901699	0.345	cellular response to nitrogen compound
GO:0006955	0.344	immune response
GO:0010243	0.340	response to organonitrogen compound
GO:0051707	0.318	response to other organism
GO:0071417	0.313	cellular response to organonitrogen compound
GO:0006952	0.308	defense response
GO:0050790	0.302	regulation of catalytic activity
GO:0032101	0.301	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.980	cytosol
GO:0099080	0.629	supramolecular complex
GO:0035770	0.619	ribonucleoprotein granule
GO:0036464	0.350	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]