StarFunc result for job id O15525

User Input

>input (162 residues)
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART
VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q76MX4	0.764	0.662	6.416E-18	189	0.988	0.847	Q76MX4.pdb.gz	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
2	AFDB:Q6NW89	0.641	0.608	1.107E-17	171	0.907	0.860	Q6NW89.pdb.gz	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1
3	AFDB:A0A024R804	0.651	0.675	5.164E-14	156	0.673	0.699	A0A024R804.pdb.gz
4	AFDB:A0A0R4IVU1	0.709	0.731	6.423E-13	157	0.710	0.732	A0A0R4IVU1.pdb.gz	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
5	AFDB:Q9ULX9	0.639	0.632	5.099E-10	164	0.574	0.567	Q9ULX9.pdb.gz	MAFF_HUMAN Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=2
6	AFDB:Q7T3H0	0.631	0.647	6.696E-10	158	0.512	0.525	Q7T3H0.pdb.gz	Q7T3H0_DANRE Transcription factor MafF OS=Danio rerio OX=7955 GN=maft PE=2 SV=1
7	AFDB:A3KMR8	0.608	0.317	1.559E-7	315	0.352	0.181	A3KMR8.pdb.gz	MAFA_DANRE Transcription factor MafAa OS=Danio rerio OX=7955 GN=mafaa PE=2 SV=1
8	AFDB:F6WVZ0	0.633	0.637	1.913E-7	161	0.383	0.385	F6WVZ0.pdb.gz	F6WVZ0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC778757 PE=1 SV=1
9	AFDB:D3ZNT6	0.585	0.265	2.347E-7	361	0.383	0.172	D3ZNT6.pdb.gz	MAFA_RAT Transcription factor MafA OS=Rattus norvegicus OX=10116 GN=Mafa PE=1 SV=1
10	AFDB:P54841	0.620	0.317	7.473E-7	323	0.370	0.186	P54841.pdb.gz	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
11	PDB:6yxxBS	0.264	0.266	2.022	161	0.093	0.093	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:7rdqD	0.158	0.023	2.317	1366	0.043	0.005	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
13	PDB:7nvmP	0.188	0.165	2.843	190	0.056	0.047	7nvmP.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
14	PDB:3eqlD	0.153	0.023	3.258	1321	0.043	0.005	3eqlD.pdb.gz	Transcription inactivation through local refolding of the RNA polymerase structure.
15	PDB:3j6bT	0.146	0.119	3.258	209	0.099	0.077	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
16	PDB:6yxxA2	0.176	0.080	3.487	463	0.086	0.030	6yxxA2.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
17	PDB:2if4A	0.118	0.084	4.278	258	0.043	0.027	2if4A.pdb.gz
18	PDB:1no4A	0.167	0.305	4.903	77	0.123	0.260	1no4A.pdb.gz
19	PDB:7v2wI	0.225	0.173	4.903	240	0.105	0.071	7v2wI.pdb.gz
20	PDB:2uwjE	0.142	0.296	5.248	70	0.056	0.129	2uwjE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15525	1.08e-114	323	162	1.000	1.000	MAFG_HUMAN Transcription factor MafG OS=Homo sapiens OX=9606 GN=MAFG PE=1 SV=1
2	O54790	1.13e-113	320	162	0.988	0.988	MAFG_MOUSE Transcription factor MafG OS=Mus musculus OX=10090 GN=Mafg PE=1 SV=1
3	Q76MX4	3.44e-107	305	189	0.988	0.847	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
4	Q6I6N2	2.74e-103	294	162	0.889	0.889	Q6I6N2_DANRE Transcription factor MafG OS=Danio rerio OX=7955 GN=mafg1 PE=2 SV=1
5	Q6NW89	4.77e-102	291	171	0.907	0.860	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1
6	O60675	2.82e-76	226	156	0.722	0.750	MAFK_HUMAN Transcription factor MafK OS=Homo sapiens OX=9606 GN=MAFK PE=1 SV=1
7	Q61827	5.39e-76	225	156	0.716	0.744	MAFK_MOUSE Transcription factor MafK OS=Mus musculus OX=10090 GN=Mafk PE=1 SV=1
8	Q6IRI7	2.31e-75	224	156	0.710	0.737	Q6IRI7_RAT V-maf musculoaponeurotic fibrosarcoma oncogene homolog K (Avian) OS=Rattus norvegicus OX=10116 GN=Mafk PE=1 SV=1
9	Q4V999	5.55e-75	223	154	0.704	0.740	Q4V999_DANRE Transcription factor MafK OS=Danio rerio OX=7955 GN=mafk PE=2 SV=1
10	A0A0R4IVU1	4.46e-74	220	157	0.698	0.720	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
11	Q9ULX9	2.90e-58	181	164	0.617	0.610	MAFF_HUMAN Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=2
12	O54791	7.49e-58	179	156	0.617	0.641	MAFF_MOUSE Transcription factor MafF OS=Mus musculus OX=10090 GN=Maff PE=2 SV=1
13	B0QY70	1.00e-54	170	125	0.531	0.688	B0QY70_HUMAN MAF bZIP transcription factor F (Fragment) OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=8
14	Q7T3H0	3.80e-52	165	158	0.562	0.576	Q7T3H0_DANRE Transcription factor MafF OS=Danio rerio OX=7955 GN=maft PE=2 SV=1
15	F6WVZ0	9.39e-37	126	161	0.352	0.354	F6WVZ0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC778757 PE=1 SV=1
16	Q4QPP9	6.92e-30	107	132	0.321	0.394	Q4QPP9_DROME GH02096p OS=Drosophila melanogaster OX=7227 GN=maf-S PE=2 SV=1
17	A0A0B4LH09	7.80e-30	107	137	0.321	0.380	A0A0B4LH09_DROME Maf-S, isoform B OS=Drosophila melanogaster OX=7227 GN=maf-S PE=4 SV=1
18	P54841	9.39e-30	112	323	0.389	0.195	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
19	Q9Y5Q3	5.39e-29	110	323	0.352	0.176	MAFB_HUMAN Transcription factor MafB OS=Homo sapiens OX=9606 GN=MAFB PE=1 SV=2
20	P54842	5.74e-29	110	323	0.352	0.176	MAFB_RAT Transcription factor MafB OS=Rattus norvegicus OX=10116 GN=Mafb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.24	22.8	bZIP transcription factor
2	PF07716 bZIP_2	68	15.0	Basic region leucine zipper
3	PF03131 bZIP_Maf	4.8e-30	115.3	bZIP Maf transcription factor
4	PF07989 Cnn_1N	15	17.1	Centrosomin N-terminal motif 1
5	PF04977 DivIC	0.13	23.3	Septum formation initiator
6	PF06698 DUF1192	2.3	19.7	Protein of unknown function (DUF1192)
7	PF13747 DUF4164	1e+02	14.6	Domain of unknown function (DUF4164)
8	PF03961 FapA	1.1e+02	13.9	Flagellar Assembly Protein A beta solenoid domain
9	PF14932 HAUS-augmin3	88	14.0	HAUS augmin-like complex subunit 3
10	PF13675 PilJ	2.7e+02	13.0	Type IV pili methyl-accepting chemotaxis transducer N-term
11	PF05478 Prominin	32	14.1	Prominin
12	PF12821 ThrE_2	35	16.0	Threonine/Serine exporter, ThrE
13	PF15642 Tox-ODYAM1	4.2e+02	11.3	Toxin in Odyssella and Amoebophilus
14	PF06156 YabA	5.1e+02	12.7	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009135

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007294	0.972	Nuclear factor, erythroid 2-like 2
2	61853.ENSNLEP00000002936	0.950	Nuclear factor, erythroid 2-like 1
3	61853.ENSNLEP00000021427	0.925	Nuclear factor, erythroid 2
4	61853.ENSNLEP00000018142	0.805	Nuclear factor, erythroid 2-like 3
5	61853.ENSNLEP00000004088	0.789	BTB and CNC homology 1, basic leucine zipper transcription factor 1
6	61853.ENSNLEP00000002506	0.758	FosB proto-oncogene, AP-1 transcription factor subunit
7	61853.ENSNLEP00000016142	0.752	BTB and CNC homology 1, basic leucine zipper transcription factor 2
8	61853.ENSNLEP00000018312	0.696	MAF bZIP transcription factor F
9	61853.ENSNLEP00000010463	0.652	MAF bZIP transcription factor K
10	61853.ENSNLEP00000019981	0.604	Fos proto-oncogene, AP-1 transcription factor subunit
11	61853.ENSNLEP00000021069	0.582	Hemoglobin, epsilon 1
12	61853.ENSNLEP00000019998	0.560	Jun dimerization protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	0.996	sequence-specific double-stranded DNA binding
GO:0000976	0.916	transcription cis-regulatory region binding
GO:0000981	0.897	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0046983	0.844	protein dimerization activity
GO:0046982	0.810	protein heterodimerization activity
GO:0000977	0.743	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.657	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.606	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0048522	0.957	positive regulation of cellular process
GO:0010604	0.937	positive regulation of macromolecule metabolic process
GO:0045893	0.911	positive regulation of DNA-templated transcription
GO:0009987	0.474	cellular process
GO:0006357	0.407	regulation of transcription by RNA polymerase II
GO:0008152	0.320	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005667	0.999	transcription regulator complex
GO:0005654	0.987	nucleoplasm
GO:0090575	0.796	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]