StarFunc result for job id O15528

User Input

>input (508 residues)
MTQTLKYASRVFHRVRWAPELGASLGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSR
LHELQVQGAAHFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCR
QRACGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPP
ALVRDVAGEFYKFGLEGIAAVLLGSRLGCLEAQVPPDTETFIRAVGSVFVSTLLTMAMPH
WLRHLVPGPWGRLCRDWDQMFAFAQRHVERREAEAAMRNGGQPEKDLESGAHLTHFLFRE
ELPAQSILGNVTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAALSPGSSAYPS
ATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPA
QFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQP
EPGAAPVRPKTRTVLVPERSINLQFLDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15528	1.000	1.000	2.718E-81	508	1.000	1.000	O15528.pdb.gz	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
2	AFDB:O35084	0.925	0.926	8.428E-68	507	0.801	0.803	O35084.pdb.gz	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
3	AFDB:A0A140LGN8	0.898	0.902	2.186E-51	506	0.516	0.518	A0A140LGN8.pdb.gz
4	AFDB:P17178	0.886	0.845	3.514E-44	533	0.415	0.396	P17178.pdb.gz	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
5	AFDB:Q4G0S4	0.882	0.828	8.834E-44	542	0.404	0.378	Q4G0S4.pdb.gz	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
6	AFDB:Q9DBG1	0.891	0.850	1.608E-43	533	0.411	0.392	Q9DBG1.pdb.gz	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
7	AFDB:Q02318	0.890	0.852	6.122E-43	531	0.388	0.371	Q02318.pdb.gz	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
8	AFDB:O73684	0.825	0.825	2.146E-37	508	0.323	0.323	O73684.pdb.gz	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
9	AFDB:Q9QZ82	0.867	0.839	1.295E-36	526	0.313	0.302	Q9QZ82.pdb.gz	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
10	AFDB:P14137	0.878	0.849	2.150E-36	526	0.309	0.298	P14137.pdb.gz	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
11	PDB:3na1A	0.859	0.922	4.175E-34	472	0.307	0.331	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
12	PDB:3k9vA	0.822	0.896	1.099E-33	464	0.309	0.338	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
13	PDB:3mzsA	0.853	0.920	7.976E-33	470	0.299	0.323	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.
14	PDB:7m8iA	0.820	0.732	2.659E-29	572	0.289	0.257	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
15	PDB:5veuC	0.765	0.825	2.141E-22	469	0.224	0.243	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
16	PDB:7mk8B	0.751	0.816	1.075E-21	465	0.220	0.241	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
17	PDB:5te8B	0.758	0.814	3.562E-21	471	0.234	0.253	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
18	PDB:2j0dB	0.692	0.783	9.819E-21	445	0.232	0.265	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
19	PDB:5veuL	0.746	0.840	1.028E-20	448	0.234	0.266	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
20	PDB:7kvjA	0.658	0.796	1.181E-20	415	0.215	0.263	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A097HUX0	0.0	526	505	0.506	0.509	A0A097HUX0_DANRE 25-hydroxyvitamin D-1alpha-hydroxylase OS=Danio rerio OX=7955 GN=cyp27b1 PE=2 SV=1
2	O15528	0.0	1028	508	1.000	1.000	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
3	O35084	0.0	776	507	0.815	0.817	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
4	O35132	0.0	778	501	0.813	0.824	CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27b1 PE=2 SV=2
5	P17178	1.77e-135	404	533	0.415	0.396	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
6	Q4G0S4	6.61e-133	398	542	0.400	0.375	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
7	Q9DBG1	8.12e-126	379	533	0.407	0.388	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
8	Q02318	4.20e-123	372	531	0.384	0.367	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
9	O73684	1.12e-82	267	508	0.313	0.313	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
10	Q64441	4.11e-81	263	514	0.319	0.315	CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp24a1 PE=2 SV=1
11	Q7SYJ6	1.14e-80	262	509	0.329	0.328	Q7SYJ6_DANRE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Danio rerio OX=7955 GN=cyp11a1.1 PE=1 SV=1
12	Q09128	3.54e-80	261	514	0.313	0.309	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
13	Q07973	2.99e-79	258	514	0.315	0.311	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2
14	Q9QZ82	1.49e-77	254	526	0.305	0.295	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
15	P05108	2.70e-77	253	521	0.305	0.298	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
16	P00189	7.34e-77	252	520	0.309	0.302	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
17	P14137	7.15e-76	250	526	0.293	0.283	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
18	A1XRK1	1.59e-62	214	518	0.289	0.284	A1XRK1_DANRE Cytochrome P450, family 11, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp11b2 PE=1 SV=1
19	Q90X62	1.47e-59	202	351	0.230	0.333	Q90X62_CHICK Mitochondrial vitamin D 24-hydroxylase variant OS=Gallus gallus OX=9031 GN=CYP24 PE=2 SV=2
20	P15539	1.53e-58	203	500	0.299	0.304	C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11b2 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	4.1e-90	314.4	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228606

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000447173	0.994	Vitamin D3 receptor
2	9606.ENSP00000334592	0.968	Vitamin D 25-hydroxylase
3	9606.ENSP00000216862	0.925	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
4	9606.ENSP00000421725	0.864	Vitamin D-binding protein
5	9606.ENSP00000237837	0.859	Fibroblast growth factor 23
6	9606.ENSP00000282091	0.839	Parathyroid hormone
7	9606.ENSP00000260270	0.831	Adrenodoxin, mitochondrial
8	9606.ENSP00000369442	0.743	Klotho
9	9606.ENSP00000347717	0.739	7-dehydrocholesterol reductase
10	9606.ENSP00000442397	0.738	Sodium-dependent phosphate transport protein 2C
11	9606.ENSP00000260970	0.735	Peptidyl-prolyl cis-trans isomerase G
12	9606.ENSP00000225174	0.701	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
13	9606.ENSP00000352358	0.674	Transient receptor potential cation channel subfamily V member 6
14	9606.ENSP00000242057	0.663	Aryl hydrocarbon receptor
15	9606.ENSP00000321424	0.637	Sodium-dependent phosphate transport protein 2A
16	9606.ENSP00000265310	0.629	Transient receptor potential cation channel subfamily V member 5
17	9606.ENSP00000369547	0.624	S100 calcium binding protein G
18	9606.ENSP00000263816	0.623	Low-density lipoprotein receptor-related protein 2
19	9606.ENSP00000326424	0.609	Glutamine-dependent NAD(+) synthetase
20	9606.ENSP00000249910	0.606	Methyl-CpG-binding domain protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016709	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005488	0.800	binding
GO:0097159	0.375	organic cyclic compound binding
GO:0008395	0.339	steroid hydroxylase activity
GO:1901363	0.332	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:1901615	0.992	organic hydroxy compound metabolic process
GO:0009987	0.991	cellular process
GO:0044281	0.985	small molecule metabolic process
GO:0008202	0.974	steroid metabolic process
GO:0044237	0.966	cellular metabolic process
GO:0006766	0.965	vitamin metabolic process
GO:0065007	0.894	biological regulation
GO:0006775	0.881	fat-soluble vitamin metabolic process
GO:0050896	0.830	response to stimulus
GO:0042221	0.506	response to chemical
GO:0009058	0.480	biosynthetic process
GO:1901576	0.470	organic substance biosynthetic process
GO:0050789	0.375	regulation of biological process
GO:0050794	0.322	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.989	mitochondrion
GO:0016020	0.978	membrane
GO:0031090	0.955	organelle membrane
GO:0012505	0.597	endomembrane system
GO:0098588	0.371	bounding membrane of organelle
GO:0070013	0.356	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.13.-	1.000	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:43836	0.339	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)

[back to server]