StarFunc result for job id O15530

User Input

>input (556 residues)
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55173	0.618	0.615	6.056E-91	559	0.959	0.953	O55173.pdb.gz	PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Pdpk1 PE=1 SV=2
2	AFDB:Q9W0V1	0.549	0.373	8.288E-48	836	0.433	0.288	Q9W0V1.pdb.gz	PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster OX=7227 GN=Pdk1 PE=1 SV=4
3	AFDB:Q54TW2	0.520	0.425	6.950E-44	686	0.396	0.321	Q54TW2.pdb.gz	PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum OX=44689 GN=pdkA PE=3 SV=1
4	AFDB:Q12701	0.492	0.463	1.172E-43	592	0.369	0.346	Q12701.pdb.gz	KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ksg1 PE=1 SV=2
5	AFDB:Q54PK9	0.509	0.318	8.980E-43	908	0.356	0.218	Q54PK9.pdb.gz	PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum OX=44689 GN=pdkB PE=3 SV=1
6	AFDB:Q9XF67	0.483	0.546	1.357E-41	491	0.327	0.371	Q9XF67.pdb.gz	PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PDPK1 PE=1 SV=1
7	AFDB:Q5I6E8	0.487	0.546	6.850E-41	494	0.322	0.362	Q5I6E8.pdb.gz	Q5I6E8_SOLLC non-specific serine/threonine protein kinase OS=Solanum lycopersicum OX=4081 GN=Pdk1 PE=1 SV=1
8	AFDB:Q9Y7J6	0.514	0.518	7.604E-41	551	0.311	0.314	Q9Y7J6.pdb.gz	PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk21 PE=1 SV=3
9	AFDB:Q03407	0.483	0.352	7.044E-36	766	0.329	0.239	Q03407.pdb.gz	PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKH1 PE=1 SV=1
10	AFDB:Q5A3P6	0.496	0.296	7.314E-33	947	0.299	0.175	Q5A3P6.pdb.gz	PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PKH2 PE=1 SV=2
11	PDB:4c0tA	0.476	0.891	8.956E-30	291	0.263	0.502	4c0tA.pdb.gz
12	PDB:4mk0A	0.467	0.413	8.870E-28	631	0.219	0.193	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
13	PDB:3pvuA	0.476	0.435	1.037E-27	609	0.219	0.200	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
14	PDB:6byrA	0.482	0.656	2.508E-26	405	0.192	0.264	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
15	PDB:5x3fB	0.477	0.749	8.337E-26	349	0.189	0.301	5x3fB.pdb.gz
16	PDB:7myjC	0.443	0.525	3.773E-24	465	0.185	0.222	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:4zhxA	0.446	0.599	3.975E-24	409	0.182	0.247	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:5u6yA	0.436	0.524	1.190E-23	459	0.189	0.229	5u6yA.pdb.gz
19	PDB:3uzsA	0.444	0.407	3.210E-23	609	0.218	0.199	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:3c4wB	0.481	0.515	5.136E-23	519	0.178	0.191	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PER6	0.0	1104	529	0.951	1.000	E9PER6_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1 PE=1 SV=1
2	O15530	0.0	1161	556	1.000	1.000	PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1 PE=1 SV=1
3	O55173	0.0	1083	559	0.959	0.953	PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Pdpk1 PE=1 SV=2
4	Q9Z2A0	0.0	1074	559	0.951	0.946	PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus OX=10090 GN=Pdpk1 PE=1 SV=2
5	Q9Y1J3	1.04e-114	356	636	0.358	0.313	PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans OX=6239 GN=pdk-1 PE=1 SV=1
6	Q12701	1.87e-103	325	592	0.387	0.363	KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ksg1 PE=1 SV=2
7	Q9XF67	1.91e-102	319	491	0.345	0.391	PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PDPK1 PE=1 SV=1
8	Q5I6E8	8.44e-101	315	494	0.327	0.368	Q5I6E8_SOLLC non-specific serine/threonine protein kinase OS=Solanum lycopersicum OX=4081 GN=Pdk1 PE=1 SV=1
9	Q4V3C8	1.51e-100	314	486	0.329	0.377	PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PDPK2 PE=1 SV=1
10	Q5A3P6	7.63e-91	301	947	0.266	0.156	PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PKH2 PE=1 SV=2
11	Q9Y7J6	4.61e-90	289	551	0.257	0.260	PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk21 PE=1 SV=3
12	Q12236	6.12e-85	287	1081	0.246	0.127	PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKH2 PE=1 SV=1
13	Q9W0V1	9.76e-84	280	836	0.272	0.181	PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster OX=7227 GN=Pdk1 PE=1 SV=4
14	Q03407	2.05e-83	277	766	0.246	0.179	PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKH1 PE=1 SV=1
15	Q54PK9	1.31e-79	270	908	0.252	0.154	PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum OX=44689 GN=pdkB PE=3 SV=1
16	Q03306	3.90e-73	252	898	0.239	0.148	PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKH3 PE=1 SV=1
17	P54644	4.46e-68	228	444	0.210	0.264	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
18	Q38DS1	3.52e-67	223	336	0.198	0.327	Q38DS1_TRYB2 Protein kinase A catalytic subunit isoform 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2360 PE=3 SV=1
19	P06245	7.52e-66	221	380	0.196	0.287	KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPK2 PE=1 SV=2
20	Q38DR5	1.06e-65	219	334	0.196	0.326	Q38DR5_TRYB2 Protein kinase A catalytic subunit isoform 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2410 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.83	20.3	ABC1 atypical kinase-like domain
2	PF01636 APH	0.46	21.8	Phosphotransferase enzyme family
3	PF13095 FTA2	18	16.4	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	3.4	18.1	Haspin like kinase domain
5	PF06293 Kdo	29	15.5	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.021	25.8	Kinase-like
7	PF14593 PH_3	2e-40	148.4	PH domain
8	PF00069 Pkinase	9.5e-64	226.9	Protein kinase domain
9	PF17667 Pkinase_fungal	0.058	23.8	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	1.1e-30	118.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344220

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.995	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000359552	0.993	Serine/threonine-protein kinase N2
3	9606.ENSP00000356832	0.992	Serine/threonine-protein kinase Sgk1
4	9606.ENSP00000225577	0.984	Ribosomal protein S6 kinase beta-1
5	9606.ENSP00000335153	0.981	Heat shock protein HSP 90-alpha
6	9606.ENSP00000367830	0.981	Protein kinase C zeta type
7	9606.ENSP00000263967	0.977	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
8	9606.ENSP00000368884	0.976	Ribosomal protein S6 kinase alpha-3
9	9606.ENSP00000375892	0.971	RAC-beta serine/threonine-protein kinase
10	9606.ENSP00000378217	0.966	Protein kinase C delta type
11	9606.ENSP00000306124	0.964	Protein kinase C epsilon type
12	9606.ENSP00000428056	0.963	Phosphatidylinositol 3-kinase regulatory subunit alpha
13	9606.ENSP00000263826	0.959	RAC-gamma serine/threonine-protein kinase
14	9606.ENSP00000380432	0.954	Insulin
15	9606.ENSP00000263125	0.953	Protein kinase C theta type
16	9606.ENSP00000295797	0.951	Protein kinase C iota type
17	9606.ENSP00000362680	0.951	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000392270	0.951	Serine-threonine kinase receptor-associated protein
19	9606.ENSP00000435412	0.949	Ribosomal protein S6 kinase alpha-1
20	9606.ENSP00000379842	0.946	Serum/glucocorticoid regulated kinase family, member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0098772	0.998	molecular function regulator activity
GO:0140677	0.827	molecular function activator activity
GO:0030234	0.806	enzyme regulator activity
GO:0008047	0.751	enzyme activator activity
GO:0019899	0.538	enzyme binding
GO:0043167	0.366	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.995	cellular process
GO:0050896	0.993	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0051716	0.927	cellular response to stimulus
GO:0048518	0.916	positive regulation of biological process
GO:0007154	0.852	cell communication
GO:0023052	0.848	signaling
GO:0019222	0.845	regulation of metabolic process
GO:0007165	0.843	signal transduction
GO:0048522	0.833	positive regulation of cellular process
GO:0048519	0.808	negative regulation of biological process
GO:0031323	0.795	regulation of cellular metabolic process
GO:0060255	0.792	regulation of macromolecule metabolic process
GO:0080090	0.791	regulation of primary metabolic process
GO:0008152	0.751	metabolic process
GO:0071704	0.737	organic substance metabolic process
GO:0048523	0.731	negative regulation of cellular process
GO:0044238	0.723	primary metabolic process
GO:0044237	0.700	cellular metabolic process
GO:0043170	0.677	macromolecule metabolic process
GO:0048583	0.667	regulation of response to stimulus
GO:0051171	0.649	regulation of nitrogen compound metabolic process
GO:0006807	0.629	nitrogen compound metabolic process
GO:0019538	0.605	protein metabolic process
GO:0016310	0.582	phosphorylation
GO:0009893	0.578	positive regulation of metabolic process
GO:0023051	0.573	regulation of signaling
GO:0010646	0.567	regulation of cell communication
GO:0009966	0.561	regulation of signal transduction
GO:0036211	0.561	protein modification process
GO:0006468	0.523	protein phosphorylation
GO:0010604	0.498	positive regulation of macromolecule metabolic process
GO:0071840	0.493	cellular component organization or biogenesis
GO:0031325	0.493	positive regulation of cellular metabolic process
GO:0042221	0.441	response to chemical
GO:0065009	0.437	regulation of molecular function
GO:0016043	0.434	cellular component organization
GO:0070887	0.420	cellular response to chemical stimulus
GO:0010033	0.419	response to organic substance
GO:0010468	0.414	regulation of gene expression
GO:0006950	0.412	response to stress
GO:0051246	0.411	regulation of protein metabolic process
GO:0051173	0.411	positive regulation of nitrogen compound metabolic process
GO:0035556	0.406	intracellular signal transduction
GO:1902531	0.400	regulation of intracellular signal transduction
GO:0044093	0.396	positive regulation of molecular function
GO:0019220	0.396	regulation of phosphate metabolic process
GO:0007166	0.396	cell surface receptor signaling pathway
GO:0051239	0.394	regulation of multicellular organismal process
GO:0048584	0.393	positive regulation of response to stimulus
GO:0010556	0.386	regulation of macromolecule biosynthetic process
GO:0031399	0.384	regulation of protein modification process
GO:0032501	0.383	multicellular organismal process
GO:0050790	0.383	regulation of catalytic activity
GO:0051128	0.374	regulation of cellular component organization
GO:0051247	0.370	positive regulation of protein metabolic process
GO:0031326	0.367	regulation of cellular biosynthetic process
GO:0010941	0.337	regulation of cell death
GO:0032502	0.335	developmental process
GO:0042981	0.333	regulation of apoptotic process
GO:0048856	0.326	anatomical structure development
GO:0071495	0.312	cellular response to endogenous stimulus
GO:0019219	0.310	regulation of nucleobase-containing compound metabolic process
GO:0071310	0.305	cellular response to organic substance
GO:0042325	0.305	regulation of phosphorylation
GO:1901700	0.303	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.995	plasma membrane
GO:0043226	0.949	organelle
GO:0043227	0.943	membrane-bounded organelle
GO:0043229	0.918	intracellular organelle
GO:0043231	0.891	intracellular membrane-bounded organelle
GO:0031982	0.750	vesicle
GO:0005634	0.631	nucleus
GO:0097708	0.315	intracellular vesicle
GO:0030054	0.303	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]