StarFunc result for job id O15533

User Input

>input (448 residues)
MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDL
DPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD
GAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDL
SFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAA
WDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPAT
LARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSV
SLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA
FLLLGLFKALGWAAVYLSTCKDSKKKAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15533	1.000	1.000	5.016E-89	448	1.000	1.000	O15533.pdb.gz	TPSN_HUMAN Tapasin OS=Homo sapiens OX=9606 GN=TAPBP PE=1 SV=2
2	AFDB:Q9R233	0.926	0.892	1.761E-72	465	0.741	0.714	Q9R233.pdb.gz	TPSN_MOUSE Tapasin OS=Mus musculus OX=10090 GN=Tapbp PE=1 SV=2
3	AFDB:A0A023IM54	0.932	0.900	6.867E-72	464	0.750	0.724	A0A023IM54.pdb.gz	A0A023IM54_RAT TAP binding protein OS=Rattus norvegicus OX=10116 GN=Tapbp PE=2 SV=1
4	PDB:6enyC	0.747	0.909	4.109E-60	364	0.812	1.000	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
5	PDB:7qpdT	0.732	0.932	1.170E-58	348	0.775	0.997	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
6	AFDB:Q3SAU8	0.680	0.689	2.541E-33	442	0.295	0.299	Q3SAU8.pdb.gz	Q3SAU8_ONCMY Tapasin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:Q53FW8	0.588	0.565	8.923E-25	468	0.241	0.231	Q53FW8.pdb.gz	Q53FW8_HUMAN TAP binding protein-like variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
8	AFDB:Q68D85	0.405	0.400	1.222E-13	454	0.116	0.115	Q68D85.pdb.gz	NR3L1_HUMAN Natural cytotoxicity triggering receptor 3 ligand 1 OS=Homo sapiens OX=9606 GN=NCR3LG1 PE=1 SV=1
9	AFDB:Q9EP73	0.364	0.536	6.187E-12	290	0.109	0.169	Q9EP73.pdb.gz	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
10	AFDB:Q8VE98	0.384	0.526	7.628E-12	316	0.141	0.199	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
11	AFDB:Q15223	0.362	0.319	1.222E-11	517	0.105	0.091	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
12	AFDB:Q6UXE8	0.352	0.340	2.542E-11	466	0.100	0.097	Q6UXE8.pdb.gz	BTNL3_HUMAN Butyrophilin-like protein 3 OS=Homo sapiens OX=9606 GN=BTNL3 PE=1 SV=2
13	PDB:5c7kF	0.199	0.364	1.054E-10	212	0.092	0.193	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
14	PDB:3u7wL	0.190	0.361	1.521E-10	210	0.089	0.190	3u7wL.pdb.gz
15	PDB:3c2aL	0.187	0.353	2.567E-10	216	0.096	0.199	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
16	PDB:4r2gP	0.191	0.371	3.003E-10	210	0.096	0.205	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
17	PDB:1i7zA	0.211	0.367	3.513E-10	219	0.100	0.205	1i7zA.pdb.gz	Crystal structure of a cocaine-binding antibody.
18	PDB:4hixL	0.205	0.363	4.809E-10	219	0.092	0.187	4hixL.pdb.gz	Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation.
19	PDB:3u0wL	0.193	0.377	5.627E-10	213	0.096	0.202	3u0wL.pdb.gz
20	PDB:1uwxL	0.200	0.375	6.248E-10	211	0.087	0.185	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A023IM54	0.0	642	464	0.732	0.707	A0A023IM54_RAT TAP binding protein OS=Rattus norvegicus OX=10116 GN=Tapbp PE=2 SV=1
2	A0A8I5ZLY7	0.0	639	479	0.730	0.683	A0A8I5ZLY7_RAT TAP binding protein OS=Rattus norvegicus OX=10116 GN=Tapbp PE=4 SV=1
3	A0A8J8Y6W0	0.0	593	473	0.699	0.662	A0A8J8Y6W0_RAT TAP binding protein OS=Rattus norvegicus OX=10116 GN=Tapbp PE=1 SV=1
4	O15533	0.0	885	448	0.998	0.998	TPSN_HUMAN Tapasin OS=Homo sapiens OX=9606 GN=TAPBP PE=1 SV=2
5	Q99JC6	0.0	639	464	0.730	0.705	Q99JC6_RAT TAP binding protein OS=Rattus norvegicus OX=10116 GN=Tapbp PE=1 SV=1
6	Q9R233	0.0	584	465	0.721	0.695	TPSN_MOUSE Tapasin OS=Mus musculus OX=10090 GN=Tapbp PE=1 SV=2
7	Q3SAV0	2.83e-47	170	442	0.306	0.310	Q3SAV0_ONCMY TAP binding protein (tapasin), tandem duplicate 1 OS=Oncorhynchus mykiss OX=8022 GN=tapbp.1 PE=2 SV=1
8	Q3SAU8	3.48e-47	170	442	0.306	0.310	Q3SAU8_ONCMY Tapasin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	Q3SAU9	7.09e-47	169	442	0.301	0.305	Q3SAU9_ONCMY Tapasin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
10	Q9BX59	2.13e-13	74.3	468	0.185	0.177	TPSNR_HUMAN Tapasin-related protein OS=Homo sapiens OX=9606 GN=TAPBPL PE=1 SV=2
11	Q53FW8	6.56e-13	72.8	468	0.266	0.254	Q53FW8_HUMAN TAP binding protein-like variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
12	P18211	6.97e-04	43.5	264	0.078	0.133	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
13	Q30059	0.004	41.2	258	0.078	0.136	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
14	Q68D85	0.006	41.2	454	0.080	0.079	NR3L1_HUMAN Natural cytotoxicity triggering receptor 3 ligand 1 OS=Homo sapiens OX=9606 GN=NCR3LG1 PE=1 SV=1
15	P18468	0.016	39.3	264	0.067	0.114	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
16	P04231	0.021	38.9	232	0.067	0.129	HB23_MOUSE H-2 class II histocompatibility antigen, E-S beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
17	P18469	0.022	38.9	264	0.067	0.114	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
18	P04230	0.023	38.9	264	0.067	0.114	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
19	A0A0G4PYZ0	0.032	38.5	266	0.067	0.113	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
20	P01911	0.034	38.5	266	0.065	0.109	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.14	23.9	Immunoglobulin C1-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000030816

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000018010	0.998	Uncharacterized protein
2	9598.ENSPTRP00000051552	0.996	Pan troglodytes protein disulfide isomerase family A, member 3 (PDIA3), mRNA
3	9598.ENSPTRP00000044308	0.991	Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
4	9598.ENSPTRP00000050302	0.983	Transporter 2, ATP binding cassette subfamily B member
5	9598.ENSPTRP00000030551	0.971	Uncharacterized protein
6	9598.ENSPTRP00000056399	0.971	Involved in the presentation of foreign antigens to the immune system
7	9598.ENSPTRP00000011997	0.970	Beta-2-microglobulin
8	9598.ENSPTRP00000061016	0.965	Patr class I histocompatibility antigen, A-5 alpha chain
9	9598.ENSPTRP00000054601	0.948	Patr class I histocompatibility antigen, alpha chain E
10	9598.ENSPTRP00000054564	0.934	Belongs to the MHC class I family.
11	9598.ENSPTRP00000016636	0.884	Protein disulfide-isomerase
12	9598.ENSPTRP00000030101	0.875	Calnexin
13	9598.ENSPTRP00000050453	0.863	annotation not available
14	9598.ENSPTRP00000055208	0.863	Uncharacterized protein
15	9598.ENSPTRP00000018169	0.811	Uncharacterized protein
16	9598.ENSPTRP00000043141	0.807	Uncharacterized protein
17	9598.ENSPTRP00000035506	0.804	Programmed cell death 1 ligand 2
18	9598.ENSPTRP00000057817	0.800	Uncharacterized protein
19	9598.ENSPTRP00000030774	0.796	Proteasome subunit beta type
20	9598.ENSPTRP00000048151	0.795	Leucyl and cystinyl aminopeptidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0044877	0.996	protein-containing complex binding
GO:0062061	0.827	TAP complex binding
GO:0015399	0.617	primary active transmembrane transporter activity
GO:0003823	0.588	antigen binding
GO:0140657	0.578	ATP-dependent activity
GO:0042605	0.556	peptide antigen binding
GO:0046977	0.449	TAP binding
GO:0042287	0.433	MHC protein binding
GO:0046979	0.409	TAP2 binding
GO:0046978	0.409	TAP1 binding
GO:0042288	0.408	MHC class I protein binding
GO:0015433	0.407	ABC-type peptide antigen transporter activity
GO:0051082	0.351	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.884	biological regulation
GO:0048002	0.884	antigen processing and presentation of peptide antigen
GO:0022607	0.779	cellular component assembly
GO:0065003	0.753	protein-containing complex assembly
GO:0050789	0.729	regulation of biological process
GO:0050896	0.713	response to stimulus
GO:0019222	0.426	regulation of metabolic process
GO:0060255	0.408	regulation of macromolecule metabolic process
GO:0050794	0.340	regulation of cellular process
GO:0010468	0.303	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098796	0.999	membrane protein complex
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0140534	0.995	endoplasmic reticulum protein-containing complex
GO:0031982	0.952	vesicle
GO:0031410	0.926	cytoplasmic vesicle
GO:0030659	0.916	cytoplasmic vesicle membrane
GO:0098588	0.902	bounding membrane of organelle
GO:0098552	0.710	side of membrane
GO:0030139	0.696	endocytic vesicle
GO:0045335	0.655	phagocytic vesicle
GO:0030670	0.651	phagocytic vesicle membrane
GO:0070013	0.385	intracellular organelle lumen
GO:0042824	0.379	MHC class I peptide loading complex
GO:0098553	0.335	lumenal side of endoplasmic reticulum membrane
GO:0005793	0.332	endoplasmic reticulum-Golgi intermediate compartment
GO:0005886	0.324	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.617	Translocases.
RHEA:14429	0.407	a [oligopeptide](in) + ATP + H2O = a [oligopeptide](out) + ADP + H(+) + phosphate
EC:7.4.2.5	0.407	bacterial ABC-type protein transporter.

[back to server]