StarFunc result for job id O15537

User Input

>input (224 residues)
MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCI
PECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSS
QWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNS
DRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15537	1.000	1.000	3.619E-45	224	1.000	1.000	O15537.pdb.gz	XLRS1_HUMAN Retinoschisin OS=Homo sapiens OX=9606 GN=RS1 PE=1 SV=2
2	PDB:3jd6O	0.692	0.915	2.405E-25	167	0.746	1.000	3jd6O.pdb.gz
3	AFDB:Q6RUW2	0.629	0.298	3.635E-17	481	0.263	0.123	Q6RUW2.pdb.gz	Q6RUW2_XENLA DEL-1 OS=Xenopus laevis OX=8355 GN=edil3.L PE=2 SV=1
4	AFDB:O35474	0.644	0.307	4.317E-17	480	0.268	0.125	O35474.pdb.gz	EDIL3_MOUSE EGF-like repeat and discoidin I-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Edil3 PE=1 SV=2
5	AFDB:Q58L90	0.651	0.104	4.842E-17	1460	0.281	0.043	Q58L90.pdb.gz	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
6	AFDB:Q9Z100	0.617	0.200	9.095E-17	722	0.299	0.093	Q9Z100.pdb.gz	CPXM1_MOUSE Probable carboxypeptidase X1 OS=Mus musculus OX=10090 GN=Cpxm1 PE=2 SV=2
7	AFDB:Q08431	0.645	0.378	1.283E-16	387	0.277	0.160	Q08431.pdb.gz	MFGM_HUMAN Lactadherin OS=Homo sapiens OX=9606 GN=MFGE8 PE=1 SV=3
8	AFDB:D3ZEB1	0.645	0.066	1.439E-16	2257	0.237	0.023	D3ZEB1.pdb.gz	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
9	AFDB:O88783	0.642	0.070	1.523E-16	2183	0.281	0.029	O88783.pdb.gz	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
10	AFDB:P00451	0.642	0.064	1.809E-16	2351	0.228	0.022	P00451.pdb.gz	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
11	AFDB:P21956	0.624	0.308	2.552E-16	463	0.232	0.112	P21956.pdb.gz	MFGM_MOUSE Lactadherin OS=Mus musculus OX=10090 GN=Mfge8 PE=1 SV=3
12	PDB:4bxsV	0.621	0.116	3.248E-15	1262	0.263	0.047	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:7kveB	0.625	0.108	2.033E-14	1374	0.268	0.044	7kveB.pdb.gz
14	PDB:2vmeA	0.544	0.478	2.976E-12	256	0.183	0.160	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
15	PDB:2w94A	0.580	0.514	4.445E-12	254	0.179	0.157	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
16	PDB:7qe7L	0.476	0.567	2.205E-5	183	0.103	0.126	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:1k12A	0.484	0.656	2.773E-5	158	0.112	0.158	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
18	PDB:1o59A	0.402	0.293	5.842E-5	318	0.071	0.050	1o59A.pdb.gz
19	PDB:6mdsA	0.415	0.132	1.639E-4	787	0.094	0.027	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
20	PDB:1xpwA	0.450	0.658	2.907E-4	143	0.054	0.084	1xpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15537	2.92e-169	466	224	1.000	1.000	XLRS1_HUMAN Retinoschisin OS=Homo sapiens OX=9606 GN=RS1 PE=1 SV=2
2	Q9Z1L4	9.75e-163	450	224	0.960	0.960	XLRS1_MOUSE Retinoschisin OS=Mus musculus OX=10090 GN=Rs1 PE=1 SV=1
3	Q08431	2.25e-29	114	387	0.272	0.158	MFGM_HUMAN Lactadherin OS=Homo sapiens OX=9606 GN=MFGE8 PE=1 SV=3
4	O88783	1.09e-28	115	2183	0.277	0.028	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
5	A0A0G2K3W2	1.24e-28	115	2259	0.281	0.028	A0A0G2K3W2_RAT Coagulation factor V OS=Rattus norvegicus OX=10116 GN=F5 PE=1 SV=2
6	Q7TPK2	1.29e-28	115	2102	0.281	0.030	Q7TPK2_RAT Ac2-120 OS=Rattus norvegicus OX=10116 GN=F5 PE=1 SV=1
7	Q7SZN0	2.37e-28	114	1460	0.277	0.042	FA5V_PSETE Venom prothrombin activator pseutarin-C non-catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=1
8	Q58L91	4.30e-28	113	1459	0.281	0.043	FA5V_OXYSU Venom prothrombin activator oscutarin-C non-catalytic subunit OS=Oxyuranus scutellatus OX=8668 PE=1 SV=1
9	Q58L90	5.91e-28	113	1460	0.281	0.043	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
10	P12259	2.45e-27	111	2224	0.268	0.027	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
11	B7ZVT7	3.31e-27	111	2087	0.277	0.030	B7ZVT7_DANRE Coagulation factor V OS=Danio rerio OX=7955 GN=si:bz20i5.3 PE=2 SV=1
12	O35474	5.46e-26	106	480	0.268	0.125	EDIL3_MOUSE EGF-like repeat and discoidin I-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Edil3 PE=1 SV=2
13	P70490	6.31e-26	105	427	0.259	0.136	MFGM_RAT Lactadherin OS=Rattus norvegicus OX=10116 GN=Mfge8 PE=2 SV=1
14	Q6RUW2	2.02e-25	105	481	0.259	0.121	Q6RUW2_XENLA DEL-1 OS=Xenopus laevis OX=8355 GN=edil3.L PE=2 SV=1
15	O43854	2.95e-25	104	480	0.259	0.121	EDIL3_HUMAN EGF-like repeat and discoidin I-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EDIL3 PE=1 SV=1
16	P21956	2.35e-24	102	463	0.241	0.117	MFGM_MOUSE Lactadherin OS=Mus musculus OX=10090 GN=Mfge8 PE=1 SV=3
17	Q96PD2	2.44e-24	102	775	0.263	0.076	DCBD2_HUMAN Discoidin, CUB and LCCL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCBLD2 PE=1 SV=1
18	P00451	1.26e-22	97.8	2351	0.228	0.022	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
19	D3ZEB1	1.68e-22	97.4	2258	0.246	0.024	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
20	Q7TN96	1.68e-22	97.4	2258	0.246	0.024	Q7TN96_RAT Factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00754 F5_F8_type_C	1.6e-23	94.6	F5/8 type C domain
2	PF09092 Lyase_N	85	14.4	Lyase, N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011791

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002578	0.990	Sterile alpha and TIR motif containing 1
2	61853.ENSNLEP00000011836	0.984	Sodium/potassium-transporting ATPase subunit beta
3	61853.ENSNLEP00000016268	0.980	ATPase, Na+/K+ transporting, alpha 3 polypeptide
4	61853.ENSNLEP00000006216	0.912	ATPase, Na+/K+ transporting, alpha 1 polypeptide
5	61853.ENSNLEP00000011145	0.645	Aryl hydrocarbon receptor interacting protein-like 1
6	61853.ENSNLEP00000012253	0.637	Zinc finger protein, X-linked
7	61853.ENSNLEP00000005650	0.617	Sodium/potassium-transporting ATPase subunit beta
8	61853.ENSNLEP00000013675	0.595	ATPase, H+/K+ exchanging, alpha polypeptide
9	61853.ENSNLEP00000016331	0.595	ATPase, Na+/K+ transporting, alpha 4 polypeptide
10	61853.ENSNLEP00000016852	0.595	ATPase, H+/K+ transporting, nongastric, alpha polypeptide
11	61853.ENSNLEP00000018167	0.584	Sodium/potassium-transporting ATPase subunit beta
12	61853.ENSNLEP00000001002	0.571	ATPase, H+/K+ exchanging, beta polypeptide
13	61853.ENSNLEP00000011828	0.571	Sex hormone-binding globulin
14	61853.ENSNLEP00000018196	0.571	Sodium/potassium-transporting ATPase subunit beta
15	61853.ENSNLEP00000017179	0.547	Zinc finger protein 408
16	61853.ENSNLEP00000010535	0.523	Zinc finger, CCHC domain containing 2
17	61853.ENSNLEP00000013293	0.523	ATP-binding cassette, sub-family A (ABC1), member 4
18	61853.ENSNLEP00000016637	0.521	SLAM family member 7
19	61853.ENSNLEP00000007348	0.520	Kelch-like family member 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.999	lipid binding
GO:0043168	0.999	anion binding
GO:0001786	0.993	phosphatidylserine binding
GO:0070273	0.991	phosphatidylinositol-4-phosphate binding
GO:0032266	0.991	phosphatidylinositol-3-phosphate binding
GO:0080025	0.991	phosphatidylinositol-3,5-bisphosphate binding
GO:0005546	0.991	phosphatidylinositol-4,5-bisphosphate binding
GO:0043325	0.990	phosphatidylinositol-3,4-bisphosphate binding
GO:0010314	0.990	phosphatidylinositol-5-phosphate binding
GO:0005547	0.990	phosphatidylinositol-3,4,5-trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0032501	0.958	multicellular organismal process
GO:0050896	0.946	response to stimulus
GO:0007275	0.942	multicellular organism development
GO:0050953	0.927	sensory perception of light stimulus
GO:0051606	0.878	detection of stimulus
GO:0009583	0.845	detection of light stimulus
GO:0009584	0.829	detection of visible light
GO:0048513	0.826	animal organ development
GO:0051716	0.791	cellular response to stimulus
GO:0007601	0.772	visual perception
GO:0048731	0.714	system development
GO:0048583	0.713	regulation of response to stimulus
GO:0071840	0.682	cellular component organization or biogenesis
GO:0016043	0.674	cellular component organization
GO:0007154	0.667	cell communication
GO:0048593	0.657	camera-type eye morphogenesis
GO:0060041	0.609	retina development in camera-type eye
GO:0023051	0.594	regulation of signaling
GO:0010646	0.594	regulation of cell communication
GO:0048646	0.562	anatomical structure formation involved in morphogenesis
GO:0023058	0.554	adaptation of signaling pathway
GO:0104004	0.511	cellular response to environmental stimulus
GO:0044085	0.419	cellular component biogenesis
GO:0007165	0.408	signal transduction
GO:0043933	0.399	protein-containing complex organization
GO:0022607	0.396	cellular component assembly
GO:0051259	0.356	protein complex oligomerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	0.999	plasma membrane
GO:0005615	0.873	extracellular space
GO:0043226	0.803	organelle
GO:0005622	0.736	intracellular anatomical structure
GO:0043229	0.671	intracellular organelle
GO:0043227	0.636	membrane-bounded organelle
GO:0005737	0.472	cytoplasm
GO:0030054	0.404	cell junction
GO:0019897	0.302	extrinsic component of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]