StarFunc result for job id O15540

User Input

>input (132 residues)
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKN
TEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTF
GDVVAVRHYEKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15540	1.000	1.000	1.771E-22	132	1.000	1.000	O15540.pdb.gz	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
2	PDB:7e25A	0.985	0.935	6.348E-21	139	0.992	0.942	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
3	AFDB:P51880	0.998	0.998	5.776E-20	132	0.871	0.871	P51880.pdb.gz	FABP7_MOUSE Fatty acid-binding protein, brain OS=Mus musculus OX=10090 GN=Fabp7 PE=1 SV=2
4	AFDB:Q8UVG7	0.989	0.982	1.979E-18	133	0.659	0.654	Q8UVG7.pdb.gz	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
5	AFDB:P07483	0.993	0.985	2.308E-18	133	0.674	0.669	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
6	AFDB:P05413	0.994	0.986	2.981E-18	133	0.667	0.662	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
7	PDB:5hz9A	0.982	0.961	7.844E-18	135	0.659	0.644	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
8	PDB:7yf1A	0.982	0.975	8.690E-18	133	0.636	0.632	7yf1A.pdb.gz
9	AFDB:O97788	0.988	0.988	2.697E-17	132	0.568	0.568	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
10	PDB:3nr3A	0.993	0.971	3.127E-17	135	0.583	0.570	3nr3A.pdb.gz
11	AFDB:P02689	0.991	0.991	3.484E-17	132	0.591	0.591	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
12	AFDB:F1MHQ4	0.991	0.991	6.781E-17	132	0.568	0.568	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
13	AFDB:P04117	0.987	0.987	1.132E-16	132	0.568	0.568	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
14	AFDB:A0A0K0MJN3	0.991	0.991	1.389E-16	132	0.561	0.561	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
15	PDB:3p6dA	0.973	0.925	5.505E-16	139	0.561	0.532	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
16	PDB:2qm9A	0.957	0.910	8.729E-16	139	0.553	0.525	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
17	PDB:4a60A	0.969	0.908	8.729E-16	141	0.523	0.489	4a60A.pdb.gz
18	PDB:5bvsA	0.957	0.957	6.434E-15	132	0.561	0.561	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
19	PDB:4azqA	0.977	0.949	1.074E-14	136	0.409	0.397	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
20	PDB:5ggeA	0.896	0.916	1.985E-14	129	0.500	0.512	5ggeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15540	1.55e-95	272	132	1.000	1.000	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
2	Q05423	4.10e-88	253	132	0.917	0.917	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
3	P55051	3.43e-84	244	132	0.886	0.886	FABP7_RAT Fatty acid-binding protein, brain OS=Rattus norvegicus OX=10116 GN=Fabp7 PE=1 SV=2
4	P51880	6.36e-83	240	132	0.871	0.871	FABP7_MOUSE Fatty acid-binding protein, brain OS=Mus musculus OX=10090 GN=Fabp7 PE=1 SV=2
5	Q8UVG7	7.44e-65	195	133	0.659	0.654	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
6	P07483	1.38e-64	194	133	0.674	0.669	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
7	P05413	7.12e-63	190	133	0.667	0.662	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
8	P11404	3.60e-62	188	133	0.644	0.639	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
9	P02689	2.09e-52	163	132	0.591	0.591	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
10	P24526	8.60e-52	162	132	0.583	0.583	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
11	O97788	1.55e-50	159	132	0.568	0.568	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
12	P70623	4.33e-50	157	132	0.591	0.591	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
13	P15090	4.99e-50	157	132	0.568	0.568	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
14	P48035	2.14e-49	155	132	0.568	0.568	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
15	F1MHQ4	3.01e-49	155	132	0.568	0.568	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
16	P04117	5.99e-49	154	132	0.568	0.568	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
17	A0A0K0MJN3	2.06e-48	153	132	0.561	0.561	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
18	Q66I80	2.39e-47	150	134	0.553	0.545	Q66I80_DANRE Fatty acid binding protein 11a OS=Danio rerio OX=7955 GN=fabp11 PE=1 SV=1
19	Q0Z7S8	4.23e-47	150	132	0.530	0.530	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
20	Q503X5	3.68e-44	142	134	0.515	0.507	Q503X5_DANRE Adipocyte fatty acid-binding protein OS=Danio rerio OX=7955 GN=fabp11b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	2e-24	97.9	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	0.00066	31.0	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357429

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.959	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000263388	0.940	Neurogenic locus notch homolog protein 3
3	9606.ENSP00000345206	0.936	Recombining binding protein suppressor of hairless
4	9606.ENSP00000263253	0.907	Histone acetyltransferase p300
5	9606.ENSP00000262367	0.904	CREB-binding protein
6	9606.ENSP00000292599	0.902	Mastermind-like protein 1
7	9606.ENSP00000421180	0.902	Mastermind-like protein 3
8	9606.ENSP00000225916	0.901	Histone acetyltransferase KAT2A
9	9606.ENSP00000263754	0.901	Histone acetyltransferase KAT2B
10	9606.ENSP00000261531	0.900	SNW domain-containing protein 1
11	9606.ENSP00000414517	0.900	Mastermind-like domain-containing protein 1
12	9606.ENSP00000434552	0.900	Mastermind-like protein 2
13	9606.ENSP00000243167	0.768	Fatty-acid amide hydrolase 1
14	9606.ENSP00000468500	0.758	Glial fibrillary acidic protein
15	9606.ENSP00000265113	0.756	Excitatory amino acid transporter 1
16	9606.ENSP00000245206	0.742	Aspartate aminotransferase, mitochondrial
17	9606.ENSP00000280605	0.726	Transketolase-like protein 2
18	9606.ENSP00000357206	0.726	Nestin
19	9606.ENSP00000404100	0.719	Paired box protein Pax-6
20	9606.ENSP00000291700	0.713	Protein S100-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0033293	1.000	monocarboxylic acid binding
GO:0005515	0.997	protein binding
GO:0005504	0.992	fatty acid binding
GO:0036041	0.469	long-chain fatty acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.981	biological regulation
GO:0032501	0.979	multicellular organismal process
GO:0032502	0.967	developmental process
GO:0050789	0.935	regulation of biological process
GO:0009987	0.903	cellular process
GO:0048856	0.900	anatomical structure development
GO:0050794	0.897	regulation of cellular process
GO:0007275	0.862	multicellular organism development
GO:0048731	0.763	system development
GO:0007399	0.684	nervous system development
GO:0048519	0.489	negative regulation of biological process
GO:0048523	0.454	negative regulation of cellular process
GO:0048518	0.453	positive regulation of biological process
GO:0050896	0.409	response to stimulus
GO:0048522	0.374	positive regulation of cellular process
GO:0019222	0.338	regulation of metabolic process
GO:0071704	0.321	organic substance metabolic process
GO:0031323	0.304	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043229	0.935	intracellular organelle
GO:0070013	0.917	intracellular organelle lumen
GO:0043231	0.859	intracellular membrane-bounded organelle
GO:0005634	0.820	nucleus
GO:0031981	0.355	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]