StarFunc result for job id O15541

User Input

>input (343 residues)
MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKR
VTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVY
ELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRK
GPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCD
QQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15541	1.000	1.000	7.449E-60	343	1.000	1.000	O15541.pdb.gz	R113A_HUMAN E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1
2	AFDB:Q9VDP8	0.324	0.313	3.713E-35	357	0.525	0.504	Q9VDP8.pdb.gz	Q9VDP8_DROME CG4973 protein OS=Drosophila melanogaster OX=7227 GN=mdlc PE=1 SV=1
3	PDB:7dvqM	0.281	0.455	2.078E-27	191	0.557	1.000	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
4	PDB:6ff4t	0.254	0.455	4.555E-23	172	0.496	0.988	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
5	PDB:5gm6a	0.189	0.501	1.579E-11	123	0.169	0.472	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
6	PDB:4r8pL	0.177	0.235	1.335E-3	254	0.055	0.075	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
7	PDB:5dkaA	0.171	0.588	1.711E-3	96	0.047	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
8	AFDB:P35820	0.164	0.039	2.585E-3	1601	0.134	0.029	P35820.pdb.gz	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
9	PDB:7qcdC	0.168	0.211	1.413E-2	267	0.047	0.060	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
10	PDB:3m62A	0.183	0.069	1.927E-2	955	0.050	0.018	3m62A.pdb.gz
11	AFDB:Q5A0E5	0.077	0.084	2.571E-2	310	0.125	0.139	Q5A0E5.pdb.gz	NRG1_CANAL Transcriptional regulator NRG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NRG1 PE=2 SV=1
12	PDB:2c2lA	0.194	0.232	3.369E-2	281	0.038	0.046	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
13	PDB:5a31B	0.133	0.507	4.059E-2	84	0.044	0.179	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
14	AFDB:A0A024RDY6	0.071	0.051	6.524E-2	532	0.157	0.102	A0A024RDY6.pdb.gz
15	AFDB:Q07351	0.092	0.073	6.524E-2	490	0.128	0.090	Q07351.pdb.gz	STP4_YEAST Zinc finger protein STP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STP4 PE=1 SV=2
16	AFDB:Q5BIH1	0.072	0.041	6.524E-2	803	0.155	0.066	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
17	AFDB:A0A2R8Q3C5	0.079	0.048	7.386E-2	672	0.175	0.089	A0A2R8Q3C5.pdb.gz
18	PDB:7oikA	0.167	0.014	7.551E-2	4426	0.052	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
19	AFDB:O62486	0.088	0.048	9.468E-2	871	0.155	0.061	O62486.pdb.gz	O62486_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=1
20	AFDB:Q99JZ7	0.072	0.059	1.374E-1	461	0.137	0.102	Q99JZ7.pdb.gz	ERRFI_MOUSE ERBB receptor feedback inhibitor 1 OS=Mus musculus OX=10090 GN=Errfi1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15541	0.0	713	343	1.000	1.000	R113A_HUMAN E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1
2	Q9VDP8	1.16e-125	366	357	0.534	0.513	Q9VDP8_DROME CG4973 protein OS=Drosophila melanogaster OX=7227 GN=mdlc PE=1 SV=1
3	O17917	3.07e-85	264	384	0.402	0.359	RN113_CAEEL Probable E3 ubiquitin-protein ligase rnf113 OS=Caenorhabditis elegans OX=6239 GN=rnf-113 PE=2 SV=2
4	Q55G16	4.01e-43	154	355	0.219	0.211	RN113_DICDI RING finger protein 113 homolog OS=Dictyostelium discoideum OX=44689 GN=rnf113 PE=4 SV=1
5	P53769	1.45e-40	145	259	0.175	0.232	CWC24_YEAST Pre-mRNA-splicing factor CWC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWC24 PE=1 SV=1
6	Q9P6R8	7.25e-37	141	533	0.259	0.167	CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf24 PE=1 SV=1
7	Q02398	8.57e-05	46.6	443	0.082	0.063	RAD18_EMENI Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uvsH PE=2 SV=1
8	O74747	1.01e-04	46.2	387	0.044	0.039	RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp18 PE=3 SV=1
9	P43254	1.12e-04	46.2	675	0.082	0.041	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
10	P10862	5.79e-04	43.9	487	0.044	0.031	RAD18_YEAST Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD18 PE=1 SV=1
11	O13033	7.80e-04	43.9	1057	0.058	0.019	RAG1_DANRE V(D)J recombination-activating protein 1 OS=Danio rerio OX=7955 GN=rag1 PE=1 SV=1
12	Q86WT6	0.001	42.7	500	0.067	0.046	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
13	P93744	0.002	42.4	425	0.061	0.049	P93744_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE2 PE=1 SV=1
14	Q69ZS0	0.002	42.7	1063	0.087	0.028	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
15	Q9BYE7	0.002	42.0	350	0.064	0.063	PCGF6_HUMAN Polycomb group RING finger protein 6 OS=Homo sapiens OX=9606 GN=PCGF6 PE=1 SV=2
16	A0A0B4LHT4	0.003	40.8	205	0.058	0.098	A0A0B4LHT4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=4 SV=1
17	H2L089	0.003	41.6	330	0.047	0.048	H2L089_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=4 SV=1
18	Q21610	0.003	42.0	627	0.047	0.026	Q21610_CAEEL Par-2 protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=2 SV=1
19	Q8I0J6	0.003	41.6	312	0.058	0.064	Q8I0J6_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=2 SV=1
20	Q9VNJ0	0.003	41.6	319	0.058	0.063	Q9VNJ0_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=dgrn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	3.3e+02	12.6	Prokaryotic RING finger family 4
2	PF00097 zf-C3HC4	0.49	21.6	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	0.0012	29.9	Zinc finger, C3HC4 type (RING finger)
4	PF13920 zf-C3HC4_3	0.00013	33.0	Zinc finger, C3HC4 type (RING finger)
5	PF15227 zf-C3HC4_4	4.6e+02	12.4	zinc finger of C3HC4-type, RING
6	PF00642 zf-CCCH	1.6e-05	35.9	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
7	PF14608 zf-CCCH_2	15	17.5	RNA-binding, Nab2-type zinc finger
8	PF18044 zf-CCCH_4	13	16.9	CCCH-type zinc finger
9	PF11789 zf-Nse	64	14.9	Zinc-finger of the MIZ type in Nse subunit
10	PF16685 zf-RING_10	1	20.8	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.038	25.7	Ring finger domain
12	PF14634 zf-RING_5	0.065	24.5	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.055	24.8	RING-type zinc-finger
14	PF18345 zf_CCCH_4	0.17	23.2	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317123	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
2	9606.ENSP00000318861	0.998	Splicing factor 3B subunit 2
3	9606.ENSP00000365625	0.998	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
4	9606.ENSP00000370460	0.997	Peptidyl-prolyl cis-trans isomerase CWC27 homolog
5	9606.ENSP00000221494	0.996	Splicing factor 3A subunit 2
6	9606.ENSP00000260210	0.996	BUD13 homolog
7	9606.ENSP00000296215	0.996	Smad nuclear-interacting protein 1
8	9606.ENSP00000387006	0.996	Pre-mRNA-splicing factor CWC22 homolog
9	9606.ENSP00000335321	0.995	Splicing factor 3B subunit 1
10	9606.ENSP00000339090	0.995	RNA binding motif protein, X-linked 2
11	9606.ENSP00000360532	0.995	Cell division cycle 5-like protein
12	9606.ENSP00000301740	0.993	Serine/arginine repetitive matrix protein 2
13	9606.ENSP00000305790	0.993	Splicing factor 3B subunit 3
14	9606.ENSP00000271628	0.992	Splicing factor 3B subunit 4
15	9606.ENSP00000392094	0.992	116 kDa U5 small nuclear ribonucleoprotein component
16	9606.ENSP00000215793	0.990	Splicing factor 3A subunit 1
17	9606.ENSP00000216252	0.990	PHD finger-like domain-containing protein 5A
18	9606.ENSP00000342374	0.990	Small nuclear ribonucleoprotein Sm D2
19	9606.ENSP00000356541	0.990	Splicing factor 3B subunit 5
20	9606.ENSP00000266735	0.989	Small nuclear ribonucleoprotein F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	0.999	ubiquitin protein ligase activity
GO:0003676	0.747	nucleic acid binding
GO:0003723	0.469	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000398	0.986	mRNA splicing, via spliceosome
GO:0050789	0.920	regulation of biological process
GO:0048519	0.899	negative regulation of biological process
GO:0050794	0.889	regulation of cellular process
GO:0060761	0.866	negative regulation of response to cytokine stimulus
GO:0048523	0.791	negative regulation of cellular process
GO:0023051	0.778	regulation of signaling
GO:0010646	0.778	regulation of cell communication
GO:0043412	0.773	macromolecule modification
GO:0070647	0.713	protein modification by small protein conjugation or removal
GO:0018149	0.700	peptide cross-linking
GO:0032446	0.699	protein modification by small protein conjugation
GO:0001959	0.696	regulation of cytokine-mediated signaling pathway
GO:0016567	0.657	protein ubiquitination
GO:0023057	0.638	negative regulation of signaling
GO:0010648	0.638	negative regulation of cell communication
GO:0001960	0.598	negative regulation of cytokine-mediated signaling pathway
GO:0018205	0.566	peptidyl-lysine modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005684	0.996	U2-type spliceosomal complex
GO:0071011	0.968	precatalytic spliceosome
GO:0071005	0.962	U2-type precatalytic spliceosome
GO:1902494	0.864	catalytic complex
GO:0005737	0.335	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]