StarFunc result for job id O15544

User Input

>input (149 residues)
MKEALHQIVVRCSELVSSTSLPRLSVSRLQGPPDSQPLGTLGQGGWKLLGIVGSLAPETL
GGLGTEFGPCTHPLPFDMVRERERDDELRQGWLLQCPQCARTLLCHCGPFLTPPSQTSSS
GFQLCSLKPSGSLVTATEPLSNFAFSYFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q385R5	0.178	0.108	1.221	314	0.148	0.070	Q385R5.pdb.gz	Q385R5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2680 PE=4 SV=1
2	AFDB:Q03430	0.143	0.071	2.003	361	0.081	0.033	Q03430.pdb.gz	RSM28_YEAST Small ribosomal subunit protein mS46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM28 PE=1 SV=2
3	AFDB:D4AAN8	0.117	0.025	4.363	1087	0.208	0.029	D4AAN8.pdb.gz	D4AAN8_RAT DNA helicase B OS=Rattus norvegicus OX=10116 GN=Helb PE=1 SV=3
4	AFDB:Q5AWT0	0.116	0.026	5.790	1050	0.174	0.025	Q5AWT0.pdb.gz	Q5AWT0_EMENI Sodium ion/proton exchanger (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07250 PE=3 SV=1
5	AFDB:Q6PB60	0.114	0.042	6.671	539	0.154	0.043	Q6PB60.pdb.gz	GASP3_MOUSE G protein-coupled receptor associated sorting protein 3 OS=Mus musculus OX=10090 GN=Gprasp3 PE=1 SV=1
6	AFDB:Q38CH9	0.116	0.064	7.160	324	0.168	0.077	Q38CH9.pdb.gz	Q38CH9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7640 PE=4 SV=1
7	AFDB:Q6X7K1	0.139	0.093	7.685	260	0.168	0.096	Q6X7K1.pdb.gz	WOX2_ARATH WUSCHEL-related homeobox 2 OS=Arabidopsis thaliana OX=3702 GN=WOX2 PE=2 SV=1
8	AFDB:O46341	0.148	0.069	8.248	409	0.201	0.073	O46341.pdb.gz	A6_DROME Protein a6 OS=Drosophila melanogaster OX=7227 GN=a6 PE=1 SV=1
9	AFDB:A0A6I8RQZ3	0.146	0.036	8.853	868	0.141	0.024	A0A6I8RQZ3.pdb.gz	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
10	AFDB:O82277	0.110	0.056	8.853	361	0.134	0.055	O82277.pdb.gz	TCP10_ARATH Transcription factor TCP10 OS=Arabidopsis thaliana OX=3702 GN=TCP10 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q57XB0	0.65	32.3	904	0.094	0.015	Q57XB0_TRYB2 Oligopeptidase B protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.30 PE=3 SV=1
2	P32170	0.66	32.0	419	0.128	0.045	RHAA_ECOLI L-rhamnose isomerase OS=Escherichia coli (strain K12) OX=83333 GN=rhaA PE=1 SV=2
3	Q5ASQ8	3.0	30.4	1501	0.074	0.007	Q5ASQ8_EMENI Phospholipid-transporting ATPase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN8672.2 PE=3 SV=1
4	A0A222NNM9	6.3	29.3	466	0.134	0.043	COS1_COCNU Cocosin 1 OS=Cocos nucifera OX=13894 GN=COS-1 PE=1 SV=1
5	Q2KG18	6.9	29.3	1524	0.074	0.007	Q2KG18_MAGO7 Phospholipid-transporting ATPase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g517 PE=3 SV=1
6	Q22412	8.3	28.9	408	0.081	0.029	Q22412_CAEEL Pre-mRNA-splicing factor RBM22 OS=Caenorhabditis elegans OX=6239 GN=rbm-22 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1536775.H70737_17260

Rank	PPI partner	STRING score	Description
1	1536775.H70737_17265	0.995	Involved in the catabolism of L-rhamnose (6-deoxy-L-mannose). Catalyzes the transfer of the gamma-phosphate group from ATP to the 1- hydroxyl group of L-rhamnulose to yield L-rhamnulose 1-phosphate.
2	1536775.H70737_11040	0.982	Rhamnulokinase
3	1536775.H70737_17255	0.950	Catalyzes the reversible cleavage of L-rhamnulose-1-phosphate to dihydroxyacetone phosphate (DHAP) and L-lactaldehyde.
4	1536775.H70737_11050	0.802	Belongs to the rhamnose isomerase family.
5	1536775.H70737_17270	0.701	1,2-propanediol oxidoreductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.440	cellular process
GO:0065007	0.418	biological regulation
GO:0045859	0.356	regulation of protein kinase activity
GO:0051172	0.341	negative regulation of nitrogen compound metabolic process
GO:0031324	0.341	negative regulation of cellular metabolic process
GO:0050730	0.332	regulation of peptidyl-tyrosine phosphorylation
GO:0044092	0.305	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005622	0.993	intracellular anatomical structure
GO:0005737	0.839	cytoplasm
GO:0005829	0.514	cytosol
GO:0043232	0.434	intracellular non-membrane-bounded organelle
GO:0043227	0.311	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]