StarFunc result for job id O15550

User Input

>input (1401 residues)
MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFV
RFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYY
SLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVN
TDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQ
VKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKV
QDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGT
LYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIE
EAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQL
RANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSG
QQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITG
SGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPL
SSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKP
SGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQL
SALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNS
VTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKAC
RNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFC
TNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKI
WHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFK
TIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPG
SRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDL
YEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNK
LQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWH
GRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKM
EDLMQVYDQFTLAPPLPSASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K6D0	0.659	0.675	0.000	1366	0.943	0.967	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
2	AFDB:A1L1S9	0.572	0.607	0.000	1311	0.617	0.660	A1L1S9.pdb.gz	A1L1S9_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=utxl1 PE=2 SV=1
3	AFDB:O14607	0.551	0.571	0.000	1347	0.829	0.862	O14607.pdb.gz	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
4	AFDB:O15550	1.000	1.000	0.000	1401	1.000	1.000	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
5	AFDB:P79457	0.353	0.407	0.000	1212	0.687	0.794	P79457.pdb.gz	UTY_MOUSE Histone demethylase UTY OS=Mus musculus OX=10090 GN=Uty PE=1 SV=2
6	AFDB:Q9VL07	0.342	0.419	1.937E-85	1136	0.391	0.482	Q9VL07.pdb.gz	Q9VL07_DROME LD02225p OS=Drosophila melanogaster OX=7227 GN=Utx PE=2 SV=3
7	AFDB:A0A1D5NSI1	0.344	0.246	5.465E-60	1996	0.299	0.210	A0A1D5NSI1.pdb.gz
8	AFDB:Q5ADP3	0.215	0.275	4.017E-22	1080	0.146	0.190	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
9	PDB:7ntfA	0.162	0.229	4.036E-9	918	0.053	0.081	7ntfA.pdb.gz
10	AFDB:F4HS99	0.118	0.095	8.315E-9	1797	0.085	0.066	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
11	PDB:4bujB	0.176	0.180	1.539E-8	1367	0.036	0.037	4bujB.pdb.gz
12	PDB:5udkA	0.158	0.369	5.385E-8	461	0.039	0.119	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
13	PDB:5w5iC	0.159	0.410	1.122E-7	436	0.039	0.126	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
14	PDB:4horA	0.164	0.378	1.454E-7	482	0.042	0.122	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
15	PDB:7qe7U	0.124	0.253	1.454E-7	540	0.062	0.161	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:6xt9D	0.191	0.578	2.054E-7	396	0.045	0.159	6xt9D.pdb.gz
17	PDB:8a3tJ	0.169	0.426	2.779E-7	509	0.040	0.110	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	PDB:4b7eA	0.142	0.448	3.449E-7	349	0.041	0.163	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
19	PDB:7qe7J	0.123	0.276	3.760E-7	510	0.043	0.118	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	AFDB:E9PD50	0.069	0.078	8.089E-7	1170	0.114	0.137	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6D0	2492	1316	0.893	0.951	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
2	A0A8I5ZM74	2838	1400	0.973	0.974	A0A8I5ZM74_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
3	A0A8I5ZTM6	1073	1208	0.411	0.477	A0A8I5ZTM6_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
4	A0A8I5ZXR3	2672	1418	0.948	0.937	A0A8I5ZXR3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
5	A0A8I6A5T3	2758	1452	0.972	0.938	A0A8I6A5T3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
6	A0A8I6ADI5	2585	1321	0.916	0.971	A0A8I6ADI5_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
7	A0A8I6AFH2	719	1635	0.233	0.199	A0A8I6AFH2_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=1
8	A0A8I6G9K0	1081	1150	0.404	0.492	A0A8I6G9K0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
9	A0A8I6GMA3	2595	1373	0.921	0.940	A0A8I6GMA3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
10	A0A8I6GMK8	1082	1214	0.414	0.478	A0A8I6GMK8_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
11	A1L1S9	855	1311	0.295	0.315	A1L1S9_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=utxl1 PE=2 SV=1
12	C9WPN3	814	1134	0.275	0.340	C9WPN3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Uty PE=2 SV=1
13	F1Q597	2051	1452	0.770	0.743	F1Q597_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=kdm6a PE=1 SV=2
14	G3V9U4	719	1569	0.233	0.208	G3V9U4_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=4
15	M9MRG4	646	1130	0.215	0.266	M9MRG4_DROME Utx histone demethylase, isoform D OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
16	M9PCJ7	645	934	0.215	0.322	M9PCJ7_DROME Utx histone demethylase, isoform E OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
17	O14607	2339	1347	0.830	0.863	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
18	O15054	716	1643	0.241	0.205	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
19	O15550	2921	1401	1.000	1.000	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
20	O70546	2836	1401	0.974	0.974	KDM6A_MOUSE Lysine-specific demethylase 6A OS=Mus musculus OX=10090 GN=Kdm6a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	5.6e+02	12.2	Anaphase-promoting complex, cyclosome, subunit 3
2	PF02373 JmjC	3.6e-28	109.7	JmjC domain, hydroxylase
3	PF14938 SNAP	49	14.8	Soluble NSF attachment protein, SNAP
4	PF00515 TPR_1	6.4e-26	100.3	Tetratricopeptide repeat
5	PF13414 TPR_11	0.071	24.1	TPR repeat
6	PF13424 TPR_12	7e-08	44.0	Tetratricopeptide repeat
7	PF13428 TPR_14	0.064	25.1	Tetratricopeptide repeat
8	PF13429 TPR_15	88	13.9	Tetratricopeptide repeat
9	PF13432 TPR_16	6.1e-09	47.6	Tetratricopeptide repeat
10	PF13431 TPR_17	1.2e-07	42.7	Tetratricopeptide repeat
11	PF14559 TPR_19	2e-06	39.5	Tetratricopeptide repeat
12	PF07719 TPR_2	3.4e-15	65.9	Tetratricopeptide repeat
13	PF13176 TPR_7	0.0066	27.5	Tetratricopeptide repeat
14	PF13181 TPR_8	4.1e-11	53.2	Tetratricopeptide repeat
15	PF13371 TPR_9	0.0022	29.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367203

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262189	0.999	Histone-lysine N-methyltransferase 2C
2	9606.ENSP00000264515	0.999	Retinoblastoma-binding protein 5
3	9606.ENSP00000301067	0.999	Histone-lysine N-methyltransferase 2D
4	9606.ENSP00000351446	0.999	WD repeat-containing protein 5
5	9606.ENSP00000384048	0.999	PAX-interacting protein 1
6	9606.ENSP00000340896	0.998	Set1/Ash2 histone methyltransferase complex subunit ASH2
7	9606.ENSP00000363929	0.995	Nuclear receptor coactivator 6
8	9606.ENSP00000395654	0.991	Transcription activator BRG1
9	9606.ENSP00000345837	0.989	Protein dpy-30 homolog
10	9606.ENSP00000398837	0.989	Histone-lysine N-methyltransferase 2B
11	9606.ENSP00000320147	0.988	Histone-lysine N-methyltransferase EZH2
12	9606.ENSP00000326519	0.983	PAXIP1 associated glutamate rich protein 1
13	9606.ENSP00000316578	0.979	Polycomb protein SUZ12
14	9606.ENSP00000263360	0.967	Polycomb protein EED
15	9606.ENSP00000362592	0.955	Histone-binding protein RBBP4
16	9606.ENSP00000476774	0.951	PAXIP1-associated glutamate-rich protein 1
17	9606.ENSP00000369424	0.947	Histone-binding protein RBBP7
18	9606.ENSP00000263253	0.922	Histone acetyltransferase p300
19	9606.ENSP00000262519	0.902	Histone-lysine N-methyltransferase SETD1A
20	9606.ENSP00000383042	0.901	Lysine-specific histone demethylase 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0032452	0.996	histone demethylase activity
GO:0005515	0.981	protein binding
GO:1901363	0.808	heterocyclic compound binding
GO:0097159	0.808	organic cyclic compound binding
GO:0003676	0.794	nucleic acid binding
GO:0003677	0.737	DNA binding
GO:1990841	0.712	promoter-specific chromatin binding
GO:0003690	0.506	double-stranded DNA binding
GO:0043565	0.498	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.986	regulation of gene expression
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0050896	0.983	response to stimulus
GO:0044238	0.983	primary metabolic process
GO:0051173	0.982	positive regulation of nitrogen compound metabolic process
GO:0031325	0.982	positive regulation of cellular metabolic process
GO:2001141	0.982	regulation of RNA biosynthetic process
GO:0043170	0.980	macromolecule metabolic process
GO:1901564	0.978	organonitrogen compound metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:1902680	0.973	positive regulation of RNA biosynthetic process
GO:0051716	0.972	cellular response to stimulus
GO:0009719	0.969	response to endogenous stimulus
GO:0048583	0.964	regulation of response to stimulus
GO:1901701	0.959	cellular response to oxygen-containing compound
GO:0071559	0.957	response to transforming growth factor beta
GO:0070988	0.956	demethylation
GO:0071310	0.956	cellular response to organic substance
GO:0008361	0.955	regulation of cell size
GO:0031670	0.955	cellular response to nutrient
GO:0045793	0.952	positive regulation of cell size
GO:0071295	0.952	cellular response to vitamin
GO:1904385	0.952	cellular response to angiotensin
GO:0043412	0.950	macromolecule modification
GO:0010941	0.950	regulation of cell death
GO:0010646	0.946	regulation of cell communication
GO:0006355	0.941	regulation of DNA-templated transcription
GO:0048523	0.940	negative regulation of cellular process
GO:0016570	0.934	histone modification
GO:0045893	0.922	positive regulation of DNA-templated transcription
GO:2001242	0.917	regulation of intrinsic apoptotic signaling pathway
GO:2001243	0.910	negative regulation of intrinsic apoptotic signaling pathway
GO:0071560	0.902	cellular response to transforming growth factor beta stimulus
GO:0006950	0.895	response to stress
GO:0006357	0.892	regulation of transcription by RNA polymerase II
GO:0033280	0.887	response to vitamin D
GO:0080135	0.884	regulation of cellular response to stress
GO:0033554	0.848	cellular response to stress
GO:0071453	0.848	cellular response to oxygen levels
GO:0045944	0.832	positive regulation of transcription by RNA polymerase II
GO:0036293	0.766	response to decreased oxygen levels
GO:0036294	0.598	cellular response to decreased oxygen levels
GO:0071407	0.589	cellular response to organic cyclic compound
GO:0071456	0.585	cellular response to hypoxia
GO:0071396	0.565	cellular response to lipid
GO:0044237	0.461	cellular metabolic process
GO:0032502	0.332	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1990234	0.996	transferase complex
GO:0035097	0.986	histone methyltransferase complex
GO:0005737	0.578	cytoplasm
GO:0044666	0.396	MLL3/4 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]