StarFunc result for job id O15551

User Input

>input (220 residues)
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15551	1.000	1.000	1.147E-33	220	1.000	1.000	O15551.pdb.gz	CLD3_HUMAN Claudin-3 OS=Homo sapiens OX=9606 GN=CLDN3 PE=1 SV=1
2	AFDB:Q98SR2	0.860	0.884	2.694E-25	214	0.736	0.757	Q98SR2.pdb.gz	Q98SR2_CHICK Claudin OS=Gallus gallus OX=9031 GN=cldn3 PE=1 SV=1
3	AFDB:O14493	0.850	0.893	2.076E-24	209	0.659	0.694	O14493.pdb.gz	CLD4_HUMAN Claudin-4 OS=Homo sapiens OX=9606 GN=CLDN4 PE=1 SV=1
4	AFDB:O35054	0.852	0.892	3.967E-24	210	0.618	0.648	O35054.pdb.gz	CLD4_MOUSE Claudin-4 OS=Mus musculus OX=10090 GN=Cldn4 PE=1 SV=1
5	AFDB:O95484	0.831	0.842	1.247E-23	217	0.636	0.645	O95484.pdb.gz	CLD9_HUMAN Claudin-9 OS=Homo sapiens OX=9606 GN=CLDN9 PE=1 SV=1
6	AFDB:Q90XR2	0.838	0.846	2.908E-23	218	0.586	0.592	Q90XR2.pdb.gz	Q90XR2_DANRE Claudin-3 OS=Danio rerio OX=7955 GN=cldnc PE=2 SV=1
7	AFDB:Q90XR8	0.851	0.870	8.700E-23	215	0.545	0.558	Q90XR8.pdb.gz	Q90XR8_DANRE Claudin b OS=Danio rerio OX=7955 GN=wu:fa66b05 PE=2 SV=1
8	AFDB:Q6NUZ6	0.864	0.884	9.144E-23	215	0.532	0.544	Q6NUZ6.pdb.gz	Q6NUZ6_DANRE Claudin OS=Danio rerio OX=7955 GN=zgc:85723 PE=1 SV=1
9	AFDB:B1H3P7	0.831	0.878	2.132E-22	208	0.559	0.591	B1H3P7.pdb.gz	B1H3P7_SALSA Claudin 30 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
10	AFDB:Q90XR9	0.834	0.877	2.132E-22	209	0.591	0.622	Q90XR9.pdb.gz	Q90XR9_DANRE Claudin OS=Danio rerio OX=7955 GN=cb84 PE=1 SV=1
11	PDB:5b2gC	0.756	0.485	3.985E-18	350	0.605	0.380	5b2gC.pdb.gz
12	PDB:6ov2A	0.763	0.914	1.607E-17	182	0.582	0.703	6ov2A.pdb.gz
13	PDB:5kbtA	0.633	0.156	6.000E-6	973	0.141	0.032	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
14	PDB:7ocaI	0.531	0.615	6.234E-5	185	0.150	0.178	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
15	PDB:7rz4A	0.525	0.141	6.552E-5	993	0.118	0.026	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:6jp5E	0.604	0.769	6.887E-5	169	0.145	0.189	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
17	PDB:7rzaA	0.636	0.159	2.642E-4	981	0.132	0.030	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
18	PDB:5weoA	0.550	0.136	5.578E-4	988	0.150	0.033	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:7d3eB	0.414	0.355	1.668E-3	272	0.123	0.099	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
20	PDB:6wxuB	0.454	0.378	1.754E-3	273	0.105	0.084	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15551	9.27e-160	442	220	1.000	1.000	CLD3_HUMAN Claudin-3 OS=Homo sapiens OX=9606 GN=CLDN3 PE=1 SV=1
2	Q63400	1.20e-127	361	219	0.905	0.909	CLD3_RAT Claudin-3 OS=Rattus norvegicus OX=10116 GN=Cldn3 PE=1 SV=2
3	Q9Z0G9	3.38e-120	342	219	0.909	0.913	CLD3_MOUSE Claudin-3 OS=Mus musculus OX=10090 GN=Cldn3 PE=1 SV=1
4	Q98SR2	1.35e-114	327	214	0.736	0.757	Q98SR2_CHICK Claudin OS=Gallus gallus OX=9031 GN=cldn3 PE=1 SV=1
5	Q90XR2	5.25e-99	288	218	0.600	0.606	Q90XR2_DANRE Claudin-3 OS=Danio rerio OX=7955 GN=cldnc PE=2 SV=1
6	O14493	1.75e-98	286	209	0.627	0.660	CLD4_HUMAN Claudin-4 OS=Homo sapiens OX=9606 GN=CLDN4 PE=1 SV=1
7	Q90XR9	1.20e-97	285	209	0.586	0.617	Q90XR9_DANRE Claudin OS=Danio rerio OX=7955 GN=cb84 PE=1 SV=1
8	O35054	2.06e-97	284	210	0.632	0.662	CLD4_MOUSE Claudin-4 OS=Mus musculus OX=10090 GN=Cldn4 PE=1 SV=1
9	Q5XIT8	1.21e-96	282	210	0.618	0.648	Q5XIT8_RAT Claudin OS=Rattus norvegicus OX=10116 GN=Cldn4 PE=2 SV=1
10	B1H3P7	1.61e-94	276	208	0.573	0.606	B1H3P7_SALSA Claudin 30 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
11	B9EL29	1.92e-94	276	208	0.573	0.606	B9EL29_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
12	B9EP74	6.81e-93	272	201	0.564	0.617	B9EP74_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
13	B5XFB8	1.70e-92	271	208	0.564	0.596	B5XFB8_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
14	B9ENQ3	1.13e-91	269	208	0.559	0.591	B9ENQ3_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
15	Q90XR8	2.64e-91	268	215	0.559	0.572	Q90XR8_DANRE Claudin b OS=Danio rerio OX=7955 GN=wu:fa66b05 PE=2 SV=1
16	P56747	9.39e-85	252	220	0.586	0.586	CLD6_HUMAN Claudin-6 OS=Homo sapiens OX=9606 GN=CLDN6 PE=1 SV=2
17	Q90XR4	8.20e-82	244	210	0.518	0.543	Q90XR4_DANRE Claudin OS=Danio rerio OX=7955 GN=cldnj PE=2 SV=1
18	Q6NUZ6	4.09e-81	243	215	0.545	0.558	Q6NUZ6_DANRE Claudin OS=Danio rerio OX=7955 GN=zgc:85723 PE=1 SV=1
19	Q98SR1	5.31e-78	235	216	0.555	0.565	Q98SR1_CHICK Claudin OS=Gallus gallus OX=9031 GN=cldn5 PE=2 SV=1
20	O00501	5.86e-77	232	218	0.550	0.555	CLD5_HUMAN Claudin-5 OS=Homo sapiens OX=9606 GN=CLDN5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	0.00018	32.9	PMP-22/EMP/MP20/Claudin tight junction
2	PF10242 L_HMGIC_fpl	6.6	18.5	Lipoma HMGIC fusion partner-like protein
3	PF07332 Phage_holin_3_6	97	14.4	Putative Actinobacterial Holin-X, holin superfamily III
4	PF00822 PMP22_Claudin	5e-30	116.1	PMP-22/EMP/MP20/Claudin family
5	PF15108 TMEM37	16	16.9	Voltage-dependent calcium channel gamma-like subunit protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378577

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347379	0.974	Occludin
2	9606.ENSP00000281537	0.961	Tight junction protein ZO-1
3	9606.ENSP00000465419	0.922	Tight junction protein ZO-3
4	9606.ENSP00000287916	0.864	Claudin-12
5	9606.ENSP00000295522	0.818	Claudin-1
6	9606.ENSP00000438262	0.781	Tight junction protein ZO-2
7	9606.ENSP00000403980	0.779	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
8	9606.ENSP00000263735	0.772	Epithelial cell adhesion molecule
9	9606.ENSP00000261769	0.745	Cadherin-1
10	9606.ENSP00000353475	0.740	Claudin-7
11	9606.ENSP00000409544	0.735	Claudin-4
12	9606.ENSP00000385477	0.717	Claudin-5
13	9606.ENSP00000264734	0.703	Claudin-16
14	9606.ENSP00000357005	0.697	Junctional adhesion molecule A
15	9606.ENSP00000363921	0.692	Partitioning defective 3 homolog
16	9606.ENSP00000428780	0.689	Claudin-23
17	9606.ENSP00000278927	0.681	Endothelial cell-selective adhesion molecule
18	9606.ENSP00000323264	0.679	MARVEL domain-containing protein 2
19	9606.ENSP00000271636	0.678	Cingulin
20	9606.ENSP00000064724	0.677	Claudin-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.649	identical protein binding
GO:0004888	0.564	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.973	regulation of biological process
GO:0048856	0.966	anatomical structure development
GO:0050896	0.962	response to stimulus
GO:0034330	0.959	cell junction organization
GO:0048522	0.949	positive regulation of cellular process
GO:0080090	0.897	regulation of primary metabolic process
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0032501	0.846	multicellular organismal process
GO:0045216	0.839	cell-cell junction organization
GO:0010604	0.835	positive regulation of macromolecule metabolic process
GO:0042221	0.824	response to chemical
GO:0030855	0.821	epithelial cell differentiation
GO:0051128	0.814	regulation of cellular component organization
GO:2000145	0.800	regulation of cell motility
GO:0120193	0.794	tight junction organization
GO:0048519	0.789	negative regulation of biological process
GO:0003158	0.764	endothelium development
GO:0001885	0.745	endothelial cell development
GO:0048583	0.743	regulation of response to stimulus
GO:1901700	0.727	response to oxygen-containing compound
GO:0051246	0.725	regulation of protein metabolic process
GO:0051173	0.718	positive regulation of nitrogen compound metabolic process
GO:0010033	0.658	response to organic substance
GO:0048523	0.656	negative regulation of cellular process
GO:0061041	0.654	regulation of wound healing
GO:0065009	0.616	regulation of molecular function
GO:0010468	0.586	regulation of gene expression
GO:0031323	0.568	regulation of cellular metabolic process
GO:0048584	0.498	positive regulation of response to stimulus
GO:0051247	0.484	positive regulation of protein metabolic process
GO:0007155	0.461	cell adhesion
GO:0030334	0.461	regulation of cell migration
GO:0044093	0.459	positive regulation of molecular function
GO:0007275	0.453	multicellular organism development
GO:0040017	0.440	positive regulation of locomotion
GO:0007043	0.432	cell-cell junction assembly
GO:0065008	0.422	regulation of biological quality
GO:0050793	0.396	regulation of developmental process
GO:0031325	0.390	positive regulation of cellular metabolic process
GO:0050790	0.370	regulation of catalytic activity
GO:0051716	0.349	cellular response to stimulus
GO:1901888	0.341	regulation of cell junction assembly
GO:0010605	0.328	negative regulation of macromolecule metabolic process
GO:2000147	0.318	positive regulation of cell motility
GO:0030335	0.310	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0070160	0.998	tight junction
GO:0043296	0.995	apical junction complex
GO:0005923	0.990	bicellular tight junction
GO:0032991	0.941	protein-containing complex
GO:0005622	0.920	intracellular anatomical structure
GO:0043231	0.650	intracellular membrane-bounded organelle
GO:0005737	0.564	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]