StarFunc result for job id O15553

User Input

>input (781 residues)
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGNEGNGPRPYGGGAASLRCSQPEAGRGLSRKPLSKRREKASEGLDAQGKPRTRSP
ALPGGRSPGPCRALEGGQAEVRLRRNASSAGRLQGLAGGAPGQKECRPFEVYLPSGKMRP
RSLEVTISTGEKAPANPEILLTLEEKTAANLDSATEPRARPTPDGGASADLKEGPGNPEH
SVTGRPPDTAASPRCHAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHE
RKSPGSLSPQPLPQCKRHLKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK
KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEALKQRVQRKLEQVYYFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT
VPVPEKWTTPQEIKQKIQLLHQKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVG
DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGP
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15553	1.000	1.000	0.000	781	1.000	1.000	O15553.pdb.gz	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
2	AFDB:Q9JJ26	0.251	0.254	3.807E-37	767	0.378	0.385	Q9JJ26.pdb.gz	MEFV_MOUSE Pyrin OS=Mus musculus OX=10090 GN=Mefv PE=1 SV=2
3	AFDB:Q9JJ25	0.228	0.236	2.955E-34	750	0.342	0.356	Q9JJ25.pdb.gz	MEFV_RAT Pyrin OS=Rattus norvegicus OX=10116 GN=Mefv PE=2 SV=2
4	AFDB:Q6P000	0.242	0.333	1.472E-31	564	0.157	0.218	Q6P000.pdb.gz
5	AFDB:Q6AZZ1	0.235	0.377	2.289E-29	485	0.182	0.293	Q6AZZ1.pdb.gz	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
6	AFDB:A0A1C9HIH9	0.230	0.374	1.312E-27	475	0.149	0.244	A0A1C9HIH9.pdb.gz	A0A1C9HIH9_HUMAN Erythroblast membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=3 SV=1
7	AFDB:Q9JLN5	0.239	0.328	1.206E-26	566	0.147	0.203	Q9JLN5.pdb.gz	ERMAP_MOUSE Erythroid membrane-associated protein OS=Mus musculus OX=10090 GN=Ermap PE=1 SV=2
8	AFDB:O00481	0.228	0.343	6.891E-23	513	0.119	0.181	O00481.pdb.gz	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
9	AFDB:O75677	0.238	0.574	1.200E-22	317	0.105	0.259	O75677.pdb.gz	RFPL1_HUMAN Ret finger protein-like 1 OS=Homo sapiens OX=9606 GN=RFPL1 PE=1 SV=2
10	AFDB:A6NLU0	0.233	0.615	2.608E-22	287	0.097	0.265	A6NLU0.pdb.gz	RFPLA_HUMAN Ret finger protein-like 4A OS=Homo sapiens OX=9606 GN=RFPL4A PE=1 SV=3
11	PDB:7y4sA	0.222	0.490	1.297E-19	343	0.096	0.219	7y4sA.pdb.gz
12	PDB:4b3nA	0.207	0.287	5.783E-17	557	0.085	0.118	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.182	0.342	6.041E-7	362	0.073	0.157	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7ccbA	0.164	0.695	4.208E-6	164	0.033	0.159	7ccbA.pdb.gz
15	PDB:7pzcA	0.108	0.084	1.507E-5	1010	0.041	0.032	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
16	PDB:2hm2Q	0.109	0.892	7.523E-5	89	0.038	0.337	2hm2Q.pdb.gz
17	PDB:2kn6A	0.113	0.428	9.927E-5	195	0.042	0.169	2kn6A.pdb.gz
18	PDB:5h7nB	0.105	0.176	1.049E-4	460	0.037	0.063	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
19	PDB:7m6aA	0.142	0.027	5.539E-4	4306	0.027	0.005	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	PDB:1umzA	0.122	0.303	6.542E-4	267	0.029	0.086	1umzA.pdb.gz	Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W6Z2	0.0	1007	601	0.613	0.797	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
2	O15553	0.0	1607	781	1.000	1.000	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
3	Q9JJ26	6.77e-169	508	767	0.408	0.416	MEFV_MOUSE Pyrin OS=Mus musculus OX=10090 GN=Mefv PE=1 SV=2
4	Q9JJ25	2.04e-115	368	747	0.352	0.368	MEFV_RAT Pyrin OS=Rattus norvegicus OX=10116 GN=Mefv PE=2 SV=2
5	A0A1U9X8R9	3.39e-112	352	513	0.222	0.337	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
6	P14373	3.39e-112	352	513	0.222	0.337	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
7	Q62158	1.10e-110	348	513	0.219	0.333	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
8	A0A024RCP5	1.14e-75	256	518	0.197	0.297	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
9	Q9HCM9	1.14e-75	256	518	0.197	0.297	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
10	P19474	1.80e-73	249	475	0.184	0.303	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
11	Q6AZZ1	5.86e-66	229	485	0.187	0.301	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
12	A0A1C9HIH9	9.75e-63	220	475	0.137	0.225	A0A1C9HIH9_HUMAN Erythroblast membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=3 SV=1
13	Q96PL5	9.75e-63	220	475	0.137	0.225	ERMAP_HUMAN Erythroid membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=1 SV=1
14	Q96F44	6.52e-62	218	468	0.182	0.303	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
15	Q62191	2.13e-60	213	470	0.172	0.285	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
16	Q3U7K7	2.29e-60	213	462	0.172	0.290	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
17	Q99PQ2	8.13e-59	209	467	0.184	0.308	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
18	Q9JLN5	2.02e-58	210	566	0.136	0.187	ERMAP_MOUSE Erythroid membrane-associated protein OS=Mus musculus OX=10090 GN=Ermap PE=1 SV=2
19	Q5NCC9	5.57e-56	201	485	0.169	0.272	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
20	Q923T7	6.94e-56	202	510	0.164	0.251	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07697 7TMR-HDED	4.2e+02	12.4	7TM-HD extracellular
2	PF13765 PRY	5.3e-16	69.3	SPRY-associated domain
3	PF02758 PYRIN	2.7e-21	86.8	PAAD/DAPIN/Pyrin domain
4	PF00622 SPRY	1.4e-13	62.4	SPRY domain
5	PF00643 zf-B_box	0.006	28.0	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.999	Caspase-1
2	9606.ENSP00000452746	0.999	Proline-serine-threonine phosphatase-interacting protein 1
3	9606.ENSP00000247470	0.981	Apoptosis-associated speck-like protein containing a CARD
4	9606.ENSP00000264335	0.981	14-3-3 protein epsilon
5	9606.ENSP00000357112	0.976	Interferon-inducible protein AIM2
6	9606.ENSP00000375872	0.945	Autophagy-related protein 16-1
7	9606.ENSP00000478516	0.918	NACHT, LRR and PYD domains-containing protein 1
8	9606.ENSP00000343325	0.901	Serine/threonine-protein kinase N1
9	9606.ENSP00000263341	0.895	Interleukin-1 beta
10	9606.ENSP00000435412	0.888	Ribosomal protein S6 kinase alpha-1
11	9606.ENSP00000385090	0.883	NLR family CARD domain-containing protein 4
12	9606.ENSP00000359552	0.874	Serine/threonine-protein kinase N2
13	9606.ENSP00000280357	0.831	Interleukin-18
14	9606.ENSP00000387261	0.815	Proline-serine-threonine phosphatase-interacting protein 2
15	9606.ENSP00000368884	0.804	Ribosomal protein S6 kinase alpha-3
16	9606.ENSP00000467123	0.804	NACHT, LRR and PYD domains-containing protein 7
17	9606.ENSP00000262752	0.803	Ribosomal protein S6 kinase alpha-6
18	9606.ENSP00000427015	0.803	Ribosomal protein S6 kinase alpha-2
19	9606.ENSP00000445135	0.797	NACHT, LRR and PYD domains-containing protein 2
20	9606.ENSP00000351273	0.785	Caspase-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003779	0.995	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050789	0.997	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0032652	0.979	regulation of interleukin-1 production
GO:0010033	0.975	response to organic substance
GO:0048522	0.973	positive regulation of cellular process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031347	0.971	regulation of defense response
GO:0032101	0.967	regulation of response to external stimulus
GO:0006950	0.965	response to stress
GO:0001819	0.962	positive regulation of cytokine production
GO:0032651	0.957	regulation of interleukin-1 beta production
GO:0048519	0.951	negative regulation of biological process
GO:0065009	0.948	regulation of molecular function
GO:0044419	0.944	biological process involved in interspecies interaction between organisms
GO:0009605	0.944	response to external stimulus
GO:0009607	0.941	response to biotic stimulus
GO:0051246	0.940	regulation of protein metabolic process
GO:0002376	0.933	immune system process
GO:0030162	0.927	regulation of proteolysis
GO:0044093	0.924	positive regulation of molecular function
GO:0051707	0.923	response to other organism
GO:0031323	0.921	regulation of cellular metabolic process
GO:0032732	0.915	positive regulation of interleukin-1 production
GO:0050790	0.911	regulation of catalytic activity
GO:0048523	0.895	negative regulation of cellular process
GO:0051173	0.894	positive regulation of nitrogen compound metabolic process
GO:0032731	0.892	positive regulation of interleukin-1 beta production
GO:0098542	0.891	defense response to other organism
GO:0006955	0.885	immune response
GO:0010605	0.856	negative regulation of macromolecule metabolic process
GO:0051247	0.854	positive regulation of protein metabolic process
GO:0045087	0.832	innate immune response
GO:0031325	0.821	positive regulation of cellular metabolic process
GO:0051716	0.820	cellular response to stimulus
GO:0071840	0.783	cellular component organization or biogenesis
GO:0050727	0.748	regulation of inflammatory response
GO:0034097	0.744	response to cytokine
GO:0016043	0.729	cellular component organization
GO:0048584	0.705	positive regulation of response to stimulus
GO:0048585	0.698	negative regulation of response to stimulus
GO:0051336	0.675	regulation of hydrolase activity
GO:0043085	0.640	positive regulation of catalytic activity
GO:0052547	0.621	regulation of peptidase activity
GO:0019219	0.619	regulation of nucleobase-containing compound metabolic process
GO:0051241	0.602	negative regulation of multicellular organismal process
GO:2000116	0.599	regulation of cysteine-type endopeptidase activity
GO:0009889	0.587	regulation of biosynthetic process
GO:0031326	0.574	regulation of cellular biosynthetic process
GO:0031349	0.562	positive regulation of defense response
GO:0045862	0.556	positive regulation of proteolysis
GO:0001818	0.552	negative regulation of cytokine production
GO:0051128	0.550	regulation of cellular component organization
GO:0010556	0.543	regulation of macromolecule biosynthetic process
GO:0032103	0.534	positive regulation of response to external stimulus
GO:0051345	0.520	positive regulation of hydrolase activity
GO:0051252	0.512	regulation of RNA metabolic process
GO:2001141	0.475	regulation of RNA biosynthetic process
GO:0023051	0.468	regulation of signaling
GO:0010646	0.467	regulation of cell communication
GO:0006355	0.461	regulation of DNA-templated transcription
GO:0009966	0.454	regulation of signal transduction
GO:2001056	0.438	positive regulation of cysteine-type endopeptidase activity
GO:0070887	0.396	cellular response to chemical stimulus
GO:0043254	0.381	regulation of protein-containing complex assembly
GO:0071704	0.379	organic substance metabolic process
GO:0051090	0.365	regulation of DNA-binding transcription factor activity
GO:0071310	0.355	cellular response to organic substance
GO:0044238	0.345	primary metabolic process
GO:0002682	0.337	regulation of immune system process
GO:0031329	0.335	regulation of cellular catabolic process
GO:0032102	0.321	negative regulation of response to external stimulus
GO:0006807	0.317	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005856	0.715	cytoskeleton
GO:0016020	0.695	membrane
GO:0061702	0.671	inflammasome complex
GO:0015630	0.497	microtubule cytoskeleton
GO:0005875	0.350	microtubule associated complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]