StarFunc result for job id O43147

User Input

>input (1006 residues)
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAGEICHKVQELQQQAEGRKPSGVSQEALRRQGSASGKAP
ALSPQALKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPAKRPALGIRKRHSSGSASEDRLA
ACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRI
IYPGHRHEHNAGDMIEMQGFGPSLPAWHLEPLCSQGSSCLSCSSSSSPHATPSHCSCIPD
RLPLRLLCESMKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGASAGLTK
DVWSKYQKDKKNYKELELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVA
ARYQQVLAEWKACEVVVRQREREAHPATRTKFSSGSSIDSHVQRLIHRDSTISNDVFISV
DDLEPPEPQDPEDSRPKPEQEAGPGTPGTAVVEQQHSVEFDSPDSGLPSSRNYSVASGIQ
SSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAA
AYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPPNLERLRDVMCSYVWEHLDVGYVQGMC
DLLAPLLVTLDNDQLAYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMH
QNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYRE
IIRDNNMDFTDIIKFFNERAEHHDAQEILRIARDLVHKVQMLIENK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43147	1.000	1.000	0.000	1006	1.000	1.000	O43147.pdb.gz	SGSM2_HUMAN Small G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=SGSM2 PE=1 SV=4
2	AFDB:Q2NKQ1	0.521	0.462	5.879E-91	1148	0.630	0.552	Q2NKQ1.pdb.gz	SGSM1_HUMAN Small G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=SGSM1 PE=1 SV=2
3	AFDB:Q8BPQ7	0.369	0.341	5.646E-90	1093	0.624	0.575	Q8BPQ7.pdb.gz	SGSM1_MOUSE Small G protein signaling modulator 1 OS=Mus musculus OX=10090 GN=Sgsm1 PE=1 SV=2
4	AFDB:Q8IQ30	0.377	0.330	1.000E-73	1155	0.493	0.429	Q8IQ30.pdb.gz	Q8IQ30_DROME Trabuco, isoform C OS=Drosophila melanogaster OX=7227 GN=tbc PE=3 SV=3
5	AFDB:Q9VPL5	0.278	0.385	2.583E-20	715	0.142	0.200	Q9VPL5.pdb.gz	Q9VPL5_DROME LD27216p OS=Drosophila melanogaster OX=7227 GN=Tbc1d15-17 PE=1 SV=1
6	AFDB:Q9UUH7	0.273	0.367	3.074E-20	743	0.147	0.199	Q9UUH7.pdb.gz	GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp7 PE=3 SV=1
7	AFDB:Q8TC07	0.274	0.396	2.281E-18	691	0.127	0.185	Q8TC07.pdb.gz	TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2
8	AFDB:Q9CXF4	0.276	0.410	4.779E-18	671	0.121	0.182	Q9CXF4.pdb.gz	TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus OX=10090 GN=Tbc1d15 PE=1 SV=1
9	AFDB:Q9HA65	0.280	0.429	6.480E-18	648	0.120	0.187	Q9HA65.pdb.gz	TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens OX=9606 GN=TBC1D17 PE=1 SV=3
10	AFDB:Q9P2M4	0.182	0.260	1.990E-6	693	0.076	0.110	Q9P2M4.pdb.gz	TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens OX=9606 GN=TBC1D14 PE=1 SV=3
11	PDB:4z6yA	0.152	0.504	1.385E-2	273	0.030	0.110	4z6yA.pdb.gz
12	PDB:6xtbE	0.075	0.292	6.349E-2	235	0.021	0.089	6xtbE.pdb.gz
13	PDB:4mk0A	0.093	0.141	1.583E-1	631	0.020	0.032	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:3uzsA	0.095	0.149	3.618E-1	609	0.038	0.062	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
15	PDB:7nkyQ	0.084	0.185	5.352E-1	404	0.026	0.064	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
16	PDB:3pvuA	0.086	0.135	6.369E-1	609	0.018	0.030	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:2kr0A	0.086	0.191	8.269E-1	407	0.037	0.091	2kr0A.pdb.gz
18	PDB:3j16A	0.045	0.107	9.020E-1	386	0.015	0.039	3j16A.pdb.gz	Structural basis of highly conserved ribosome recycling in eukaryotes and archaea.
19	PDB:4v96Bd	0.040	0.144	9.421E-1	165	0.019	0.115	4v96Bd.pdb.gz
20	PDB:3cm1A	0.080	0.420	9.840E-1	137	0.025	0.182	3cm1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43147	0.0	2093	1006	1.000	1.000	SGSM2_HUMAN Small G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=SGSM2 PE=1 SV=4
2	Q2NKQ1	0.0	1198	1148	0.629	0.551	SGSM1_HUMAN Small G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=SGSM1 PE=1 SV=2
3	Q80U12	0.0	1907	1005	0.929	0.930	SGSM2_MOUSE Small G protein signaling modulator 2 OS=Mus musculus OX=10090 GN=Sgsm2 PE=1 SV=2
4	Q8BPQ7	0.0	1204	1093	0.634	0.584	SGSM1_MOUSE Small G protein signaling modulator 1 OS=Mus musculus OX=10090 GN=Sgsm1 PE=1 SV=2
5	Q8IQ30	3.80e-168	525	1155	0.302	0.263	Q8IQ30_DROME Trabuco, isoform C OS=Drosophila melanogaster OX=7227 GN=tbc PE=3 SV=3
6	I2HAA0	2.57e-79	280	913	0.194	0.214	TBC8_CAEEL Rab GTPase-activating protein tbc-8 OS=Caenorhabditis elegans OX=6239 GN=tbc-8 PE=1 SV=1
7	Q9VPL5	3.54e-34	143	715	0.075	0.105	Q9VPL5_DROME LD27216p OS=Drosophila melanogaster OX=7227 GN=Tbc1d15-17 PE=1 SV=1
8	Q9CXF4	1.99e-31	134	671	0.069	0.103	TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus OX=10090 GN=Tbc1d15 PE=1 SV=1
9	Q8TC07	3.07e-31	133	691	0.069	0.100	TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2
10	Q9VKV6	1.35e-26	119	702	0.067	0.095	Q9VKV6_DROME FI04439p OS=Drosophila melanogaster OX=7227 GN=TBC1D16 PE=1 SV=2
11	Q3MII6	1.23e-25	115	688	0.055	0.080	TBC25_HUMAN TBC1 domain family member 25 OS=Homo sapiens OX=9606 GN=TBC1D25 PE=1 SV=2
12	Q14830	1.58e-25	115	651	0.055	0.084	Q14830_HUMAN MG81 protein (Fragment) OS=Homo sapiens OX=9606 GN=MG81 PE=2 SV=1
13	Q9UUH7	2.11e-25	115	743	0.065	0.087	GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp7 PE=3 SV=1
14	Q8TBP0	1.87e-24	112	767	0.066	0.086	TBC16_HUMAN TBC1 domain family member 16 OS=Homo sapiens OX=9606 GN=TBC1D16 PE=2 SV=1
15	P48365	9.47e-23	107	746	0.071	0.095	GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GYP7 PE=1 SV=1
16	Q5BI03	2.29e-22	106	1098	0.056	0.051	Q5BI03_DROME LD02690p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8155 PE=2 SV=1
17	Q9HA65	2.50e-22	105	648	0.063	0.097	TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens OX=9606 GN=TBC1D17 PE=1 SV=3
18	Q0WV47	5.82e-22	102	432	0.054	0.125	Q0WV47_ARATH Uncharacterized protein At5g54780 OS=Arabidopsis thaliana OX=3702 GN=MBG8.4 PE=1 SV=1
19	Q57XM7	9.92e-21	100	718	0.064	0.089	Q57XM7_TRYB2 GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.520 PE=4 SV=1
20	Q8TEA7	1.70e-08	61.2	893	0.047	0.053	TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=TBCK PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12068 PH_RBD	4.4e-29	112.7	Rab-binding domain (RBD)
2	PF00566 RabGAP-TBC	1.1e-27	108.7	Rab-GTPase-TBC domain
3	PF02759 RUN	1.2e-29	114.5	RUN domain
4	PF02892 zf-BED	70	14.9	BED zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268989

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420127	0.850	Ras-related protein Rab-9A
2	9606.ENSP00000248929	0.833	Small G protein signaling modulator 3
3	9606.ENSP00000357336	0.780	RUN and SH3 domain-containing protein 1
4	9606.ENSP00000245304	0.770	Ras-related protein Rap-2a
5	9606.ENSP00000250559	0.770	Ras-related protein Rap-1b
6	9606.ENSP00000355651	0.756	Ras-related protein Rab-4A
7	9606.ENSP00000222256	0.745	Ras-related protein Rab-3A
8	9606.ENSP00000410862	0.728	RUN domain-containing protein 3A
9	9606.ENSP00000319096	0.707	Ras-related protein Rap-2b
10	9606.ENSP00000261839	0.703	Unconventional myosin-Vc
11	9606.ENSP00000300935	0.696	Ras-related protein Rab-8A
12	9606.ENSP00000358723	0.686	Ras-related protein Rap-1A
13	9606.ENSP00000261890	0.685	Ras-related protein Rab-11A
14	9606.ENSP00000356465	0.667	Ras-related protein Rab-32
15	9606.ENSP00000306496	0.654	Ras-related protein Rab-33B
16	9606.ENSP00000386538	0.646	TBC1 domain family member 10B
17	9606.ENSP00000225235	0.644	TBC1 domain family member 12
18	9606.ENSP00000263092	0.642	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
19	9606.ENSP00000362590	0.641	TBC1 domain family member 22B
20	9606.ENSP00000411197	0.640	TBC1 domain family member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0051641	0.986	cellular localization
GO:0006810	0.986	transport
GO:0046907	0.979	intracellular transport
GO:0016192	0.971	vesicle-mediated transport
GO:0016482	0.951	cytosolic transport
GO:0043547	0.945	positive regulation of GTPase activity
GO:0042147	0.845	retrograde transport, endosome to Golgi
GO:0050789	0.644	regulation of biological process
GO:0050794	0.585	regulation of cellular process
GO:0048193	0.403	Golgi vesicle transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031410	0.999	cytoplasmic vesicle
GO:0048770	0.985	pigment granule
GO:0042470	0.942	melanosome
GO:0005829	0.928	cytosol
GO:0012505	0.895	endomembrane system
GO:0016020	0.891	membrane
GO:0012506	0.319	vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]