StarFunc result for job id O43148

User Input

>input (476 residues)
MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRK
EFEDDLVKESSSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTG
DGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMK
SVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRY
EDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMM
LRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDF
NLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP
YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43148	1.000	1.000	2.490E-88	476	1.000	1.000	O43148.pdb.gz	MCES_HUMAN mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1
2	AFDB:Q9D0L8	0.759	0.776	1.081E-70	465	0.739	0.757	Q9D0L8.pdb.gz	MCES_MOUSE mRNA cap guanine-N7 methyltransferase OS=Mus musculus OX=10090 GN=Rnmt PE=1 SV=1
3	PDB:6rieO	0.452	0.272	3.791E-16	822	0.128	0.074	6rieO.pdb.gz	Structural Basis of Poxvirus Transcription: Transcribing and Capping Vaccinia Complexes.
4	PDB:4hh4C	0.358	0.613	1.017E-11	256	0.084	0.156	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
5	PDB:1nbhA	0.336	0.519	8.459E-10	292	0.088	0.144	1nbhA.pdb.gz	Catalytic mechanism of glycine N-methyltransferase
6	PDB:5wp5A	0.284	0.291	1.356E-9	463	0.109	0.112	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
7	PDB:3bxoA	0.313	0.578	1.716E-9	236	0.071	0.144	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
8	PDB:6orrC	0.298	0.479	3.282E-9	273	0.069	0.121	6orrC.pdb.gz	High-Affinity Alkynyl Bisubstrate Inhibitors of NicotinamideN-Methyltransferase (NNMT).
9	PDB:1tpyA	0.330	0.516	6.276E-9	285	0.097	0.161	1tpyA.pdb.gz	Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis
10	PDB:2a14A	0.325	0.547	1.350E-8	257	0.065	0.121	2a14A.pdb.gz	The Crystal Structure of Human Indolethylamine N-methyltransferase in complex with SAH.
11	PDB:5wp4A	0.299	0.294	1.519E-8	485	0.118	0.115	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
12	PDB:4ineA	0.294	0.320	1.612E-8	431	0.082	0.090	4ineA.pdb.gz	Crystal structure of N-methyl transferase (PMT-2) from Caenorhabditis elegant complexed with S-adenosyl homocysteine and phosphoethanolamine
13	AFDB:Q08641	0.319	0.249	1.141E-6	628	0.158	0.119	Q08641.pdb.gz	AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABP140 PE=1 SV=3
14	AFDB:Q0WVD6	0.262	0.215	2.182E-6	601	0.105	0.083	Q0WVD6.pdb.gz	ANM3_ARATH Probable protein arginine N-methyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=PRMT3 PE=2 SV=1
15	AFDB:A0A286YB74	0.208	0.133	2.297E-4	800	0.097	0.058	A0A286YB74.pdb.gz
16	AFDB:Q7K480	0.234	0.094	2.584E-4	1367	0.111	0.039	Q7K480.pdb.gz	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
17	AFDB:Q0WT31	0.220	0.145	4.641E-3	770	0.139	0.086	Q0WT31.pdb.gz	PMTP_ARATH Probable methyltransferase PMT25 OS=Arabidopsis thaliana OX=3702 GN=At2g34300 PE=2 SV=2
18	AFDB:O43159	0.161	0.167	5.518E-2	456	0.139	0.145	O43159.pdb.gz	RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2
19	AFDB:Q9VD51	0.145	0.110	9.380E-2	680	0.103	0.072	Q9VD51.pdb.gz	DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster OX=7227 GN=pit PE=2 SV=2
20	AFDB:O43078	0.105	0.081	1.594E-1	660	0.082	0.059	O43078.pdb.gz	ALF1_SCHPO ATPase-like fidgetin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alf1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43148	0.0	983	476	1.000	1.000	MCES_HUMAN mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1
2	Q9D0L8	0.0	726	465	0.746	0.763	MCES_MOUSE mRNA cap guanine-N7 methyltransferase OS=Mus musculus OX=10090 GN=Rnmt PE=1 SV=1
3	O74880	1.61e-53	185	360	0.256	0.339	MCES_SCHPO mRNA cap guanine-N7 methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcm1 PE=1 SV=2
4	P32783	1.09e-38	147	436	0.206	0.225	MCES_YEAST mRNA cap guanine-N7 methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABD1 PE=1 SV=1
5	Q5ADX5	2.25e-38	147	474	0.218	0.219	MCES_CANAL mRNA cap guanine-N7 methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ABD1 PE=3 SV=1
6	Q4FKP8	1.43e-22	100	324	0.170	0.250	Q4FKP8_TRYB2 mRNA (guanine-N(7))-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2720 PE=3 SV=1
7	Q57V03	9.14e-22	101	1050	0.170	0.077	Q57V03_TRYB2 mRNA (guanine-N(7))-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.530 PE=3 SV=1
8	P04298	1.41e-06	53.1	844	0.082	0.046	MCEL_VACCW mRNA-capping enzyme catalytic subunit OS=Vaccinia virus (strain Western Reserve) OX=10254 GN=OPG113 PE=1 SV=1
9	Q9NZJ6	0.32	35.8	369	0.067	0.087	COQ3_HUMAN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3
10	P46871	0.36	35.8	742	0.069	0.044	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
11	Q9C9Q8	1.9	33.5	684	0.065	0.045	PMTT_ARATH Probable pectin methyltransferase QUA2 OS=Arabidopsis thaliana OX=3702 GN=QUA2 PE=1 SV=2
12	M9NE54	2.1	33.5	2006	0.046	0.011	M9NE54_DROME Grunge, isoform G OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
13	M9NDL9	2.2	33.5	1988	0.046	0.011	M9NDL9_DROME Grunge, isoform F OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
14	M9PES2	2.2	33.5	1983	0.046	0.011	M9PES2_DROME Grunge, isoform I OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
15	M9PHT1	2.2	33.5	2007	0.046	0.011	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
16	Q7KUA8	2.2	33.5	1985	0.046	0.011	Q7KUA8_DROME Grunge, isoform D OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
17	Q86BH2	2.2	33.5	1988	0.046	0.011	Q86BH2_DROME Grunge, isoform C OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
18	Q8IQA6	2.2	33.5	1966	0.046	0.011	Q8IQA6_DROME Grunge, isoform A OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
19	Q8T9N4	2.2	33.5	1985	0.046	0.011	Q8T9N4_DROME Transcriptional corepressor Atro OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1
20	Q9NHX6	2.2	33.5	1966	0.046	0.011	Q9NHX6_DROME GRUNGE OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	5.1e-05	35.2	Methyltransferase domain
2	PF08242 Methyltransf_12	0.01	27.9	Methyltransferase domain
3	PF13489 Methyltransf_23	0.00073	30.9	Methyltransferase domain
4	PF13649 Methyltransf_25	8.1e-08	44.2	Methyltransferase domain
5	PF13847 Methyltransf_31	7.2e-06	37.3	Methyltransferase domain
6	PF13679 Methyltransf_32	28	16.1	Methyltransferase domain
7	PF05175 MTS	80	14.3	Methyltransferase small domain
8	PF03291 Pox_MCEL	1.6e-118	407.3	mRNA capping enzyme
9	PF04908 SH3BGR	30	16.2	SH3-binding, glutamic acid-rich protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307181	0.998	RNMT-activating mini protein
2	9606.ENSP00000358497	0.997	mRNA-capping enzyme
3	9606.ENSP00000362550	0.965	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
4	9606.ENSP00000364289	0.957	Nuclear cap-binding protein subunit 1
5	9606.ENSP00000326806	0.952	Nuclear cap-binding protein subunit 2
6	9606.ENSP00000425561	0.946	Eukaryotic translation initiation factor 4E
7	9606.ENSP00000470252	0.942	Transcription elongation factor SPT5
8	9606.ENSP00000258416	0.922	Eukaryotic translation initiation factor 4E type 2
9	9606.ENSP00000220592	0.919	Protein argonaute-2
10	9606.ENSP00000373657	0.901	Nuclear cap-binding protein subunit 3
11	9606.ENSP00000393324	0.860	Eukaryotic translation initiation factor 4E type 3
12	9606.ENSP00000301788	0.858	DNA-directed RNA polymerase II subunit RPB7
13	9606.ENSP00000260129	0.820	Trimethylguanosine synthase
14	9606.ENSP00000353013	0.816	C-type lectin domain containing 14A
15	9606.ENSP00000367030	0.786	tRNA (cytosine(38)-C(5))-methyltransferase
16	9606.ENSP00000264670	0.782	tRNA (cytosine(34)-C(5))-methyltransferase
17	9606.ENSP00000480158	0.782	DNA-directed RNA polymerase II subunit RPB1
18	9606.ENSP00000256443	0.775	Cyclin-dependent kinase 7
19	9606.ENSP00000323714	0.772	Eukaryotic translation initiation factor 4E type 1B
20	9606.ENSP00000370625	0.761	DNA-directed RNA polymerase II subunit RPB2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004482	1.000	mRNA (guanine-N7-)-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006396	0.990	RNA processing
GO:0036260	0.957	RNA capping
GO:0016071	0.935	mRNA metabolic process
GO:0006397	0.915	mRNA processing
GO:0065007	0.358	biological regulation
GO:0050789	0.340	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:1902494	0.995	catalytic complex
GO:0140535	0.995	intracellular protein-containing complex
GO:1990234	0.994	transferase complex
GO:0140513	0.994	nuclear protein-containing complex
GO:0005730	0.993	nucleolus
GO:0034518	0.982	RNA cap binding complex
GO:0001650	0.976	fibrillar center
GO:0034708	0.974	methyltransferase complex
GO:0043235	0.965	receptor complex
GO:0005737	0.932	cytoplasm
GO:0005829	0.788	cytosol
GO:0005845	0.747	mRNA cap binding complex
GO:0031533	0.710	mRNA cap methyltransferase complex
GO:0061695	0.329	transferase complex, transferring phosphorus-containing groups

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.56	1.000	mRNA (guanine-N(7))-methyltransferase.

[back to server]