StarFunc result for job id O43149

User Input

>input (1400 residues)
MGNAPSHSSEDEAAAAGGEGWGPHQDWAAVSGTTPGPGVAAPALPPAAALLEPARLREAA
AALLPTPPCESLVSRHRGALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFTDIFSESKEGLD
IHSSMILRFLHRNRLSSAVMPYPMLEHCNNMCTMRSSVLKESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSACSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENANVSQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALRHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVMSSLCTITDHLDTQYDASSLILSMASVRQNLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFCAEEHFKRFEKYDKWKLQELRQFVKSRIGCSSDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLTISGYLRPARAEAEQSVTCAHCR
KDTEESVCGATLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQ
NPREECVSAQTLLLQLLQSCFSVLQGDVLAASEEEKAPIQSPKGVEAAKELYTHLCDVVD
KVDGDSVPMEILKQEVRNTLLNGAAIFFPNRQTRRNHLFTMMNVTEQEHKQSLQLTFRSL
CTYFSDKDPGGLLLLPEKNDLAKMNISEVLAVMDTLVSVAARECELLMLSGAPGEVGSVL
FSLFWSVQGSLLSWCYLQLKSTDSGAKDLAVDLIEKYVGQFLASMRAILESLFSQYSGKT
IVERLCNSVFSMAARQLVIFLLDFCTLDIPHCVLLREFSVLTELLKKLCSGPEGGLRKLD
VETWQQEQPVVLHTWTKESAHNYENNCHEVSVFVSPGATYFEVEFDDRCETEKRYDYLEF
TDARGRKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSHNEWGYKFTVTACGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVRQLGSNMVVPQAKMALVLSSPLWKPVFRHQVCP
ELELEASWPTHPHRNSKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKIALSEEFAQVYSLADG
IRIWMLEMKQKSLMSLGNEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VE73	0.112	0.100	3.709E-13	1689	0.101	0.083	Q8VE73.pdb.gz	CUL7_MOUSE Cullin-7 OS=Mus musculus OX=10090 GN=Cul7 PE=1 SV=2
2	AFDB:Q14999	0.104	0.087	6.642E-13	1698	0.109	0.090	Q14999.pdb.gz	CUL7_HUMAN Cullin-7 OS=Homo sapiens OX=9606 GN=CUL7 PE=1 SV=2
3	AFDB:D3ZEF4	0.100	0.092	1.141E-12	1692	0.106	0.087	D3ZEF4.pdb.gz	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
4	AFDB:Q8IWT3	0.115	0.079	9.521E-12	2517	0.112	0.062	Q8IWT3.pdb.gz	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
5	AFDB:Q3U487	0.096	0.153	3.052E-11	861	0.048	0.078	Q3U487.pdb.gz	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
6	PDB:7z8bC	0.099	0.108	3.857E-11	1224	0.091	0.105	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
7	AFDB:Q8K2H6	0.094	0.631	4.621E-8	185	0.023	0.173	Q8K2H6.pdb.gz	APC10_MOUSE Anaphase-promoting complex subunit 10 OS=Mus musculus OX=10090 GN=Anapc10 PE=1 SV=1
8	AFDB:Q9ZPW2	0.096	0.640	1.019E-7	192	0.028	0.203	Q9ZPW2.pdb.gz	APC10_ARATH Anaphase-promoting complex subunit 10 OS=Arabidopsis thaliana OX=3702 GN=APC10 PE=1 SV=2
9	PDB:7qe7L	0.095	0.655	1.458E-7	183	0.024	0.180	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
10	AFDB:Q9V831	0.095	0.632	2.544E-7	195	0.024	0.174	Q9V831.pdb.gz	APC10_DROME Anaphase-promoting complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=APC10 PE=2 SV=2
11	AFDB:O42971	0.100	0.651	3.404E-7	189	0.031	0.228	O42971.pdb.gz	APC10_SCHPO Anaphase-promoting complex subunit 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apc10 PE=1 SV=1
12	AFDB:Q387U5	0.099	0.529	4.369E-7	235	0.025	0.149	Q387U5.pdb.gz	Q387U5_TRYB2 Anaphase-promoting complex subunit 10 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0630 PE=3 SV=1
13	PDB:1o59A	0.094	0.319	8.029E-7	318	0.034	0.151	1o59A.pdb.gz
14	PDB:8a3tA	0.098	0.561	8.725E-7	219	0.025	0.160	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:7kveB	0.118	0.120	4.937E-5	1374	0.033	0.033	7kveB.pdb.gz
16	PDB:4bxsV	0.108	0.116	1.650E-4	1262	0.021	0.023	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
17	PDB:4f7zA	0.074	0.092	2.399E-4	946	0.056	0.082	4f7zA.pdb.gz
18	PDB:1xpwA	0.083	0.671	4.867E-4	143	0.015	0.147	1xpwA.pdb.gz
19	PDB:1k12A	0.084	0.620	2.269E-3	158	0.011	0.101	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
20	PDB:1xoyA	0.088	0.612	2.570E-3	161	0.014	0.124	1xoyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43149	0.0	2902	2961	1.000	0.473	ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6
2	Q5SSH7	0.0	2594	2924	0.911	0.436	ZZEF1_MOUSE Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zzef1 PE=1 SV=2
3	Q14999	2.06e-20	100	1698	0.039	0.032	CUL7_HUMAN Cullin-7 OS=Homo sapiens OX=9606 GN=CUL7 PE=1 SV=2
4	Q8IWT3	6.98e-19	96.3	2517	0.037	0.021	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
5	E9PEZ1	7.45e-19	96.3	2489	0.037	0.021	E9PEZ1_HUMAN Cullin 9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=1
6	Q3U487	9.89e-19	95.1	861	0.034	0.055	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
7	Q5T447	1.99e-18	94.0	861	0.034	0.055	HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1
8	Q8VE73	2.96e-18	94.0	1689	0.040	0.033	CUL7_MOUSE Cullin-7 OS=Mus musculus OX=10090 GN=Cul7 PE=1 SV=2
9	D3ZEF4	4.37e-18	93.6	1692	0.036	0.030	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
10	O95714	1.16e-16	89.0	4834	0.036	0.011	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
11	Q4U2R1	1.27e-15	85.5	4836	0.035	0.010	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
12	Q9UM13	1.12e-06	52.8	185	0.024	0.184	APC10_HUMAN Anaphase-promoting complex subunit 10 OS=Homo sapiens OX=9606 GN=ANAPC10 PE=1 SV=1
13	Q8K2H6	1.90e-06	52.0	185	0.024	0.184	APC10_MOUSE Anaphase-promoting complex subunit 10 OS=Mus musculus OX=10090 GN=Anapc10 PE=1 SV=1
14	Q54L33	1.87e-05	52.0	5222	0.021	0.006	Q54L33_DICDI HECT domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286931 PE=4 SV=1
15	Q9ZPW2	3.80e-04	45.4	192	0.026	0.193	APC10_ARATH Anaphase-promoting complex subunit 10 OS=Arabidopsis thaliana OX=3702 GN=APC10 PE=1 SV=2
16	Q9V831	3.87e-04	45.4	195	0.021	0.149	APC10_DROME Anaphase-promoting complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=APC10 PE=2 SV=2
17	O42971	0.014	40.8	189	0.018	0.132	APC10_SCHPO Anaphase-promoting complex subunit 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apc10 PE=1 SV=1
18	P53068	0.035	40.0	250	0.023	0.128	APC10_YEAST Anaphase-promoting complex subunit DOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOC1 PE=1 SV=2
19	Q57WF6	0.037	38.9	149	0.014	0.134	Q57WF6_TRYB2 Centrin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.660 PE=1 SV=1
20	P07463	0.057	38.1	149	0.020	0.188	CALM_PARTE Calmodulin OS=Paramecium tetraurelia OX=5888 GN=CAM PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03256 ANAPC10	1.9e-11	55.5	Anaphase-promoting complex, subunit 10 (APC10)
2	PF00036 EF-hand_1	2	19.2	EF hand
3	PF13202 EF-hand_5	6e+02	11.4	EF hand
4	PF13405 EF-hand_6	0.76	20.8	EF-hand domain
5	PF13499 EF-hand_7	17	17.3	EF-hand domain pair
6	PF13833 EF-hand_8	1.2e+02	13.9	EF-hand domain pair
7	PF00754 F5_F8_type_C	0.23	23.0	F5/8 type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225728	0.716	Mediator of RNA polymerase II transcription subunit 31
2	9606.ENSP00000270824	0.704	Eva-1 homolog B
3	9606.ENSP00000220676	0.697	Oxygen-regulated protein 1
4	9606.ENSP00000278200	0.641	Mitochondrial inner membrane protease subunit 1
5	9606.ENSP00000006526	0.639	WD repeat-containing protein 54
6	9606.ENSP00000382330	0.618	Ring finger protein 222
7	9606.ENSP00000343635	0.607	TLD domain-containing protein 1
8	9606.ENSP00000484687	0.592	Zinc finger HIT-type containing 3
9	9606.ENSP00000446215	0.560	GTP-binding nuclear protein Ran
10	9606.ENSP00000342962	0.545	Serine incorporator 1
11	9606.ENSP00000311977	0.538	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like
12	9606.ENSP00000394899	0.533	Transmembrane protein 51
13	9606.ENSP00000326200	0.530	Zinc finger and BTB domain-containing protein 11
14	9606.ENSP00000295226	0.517	Coiled-coil domain containing 140
15	9606.ENSP00000263672	0.512	Signal peptidase complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.995	catalytic activity, acting on a protein
GO:0061659	0.993	ubiquitin-like protein ligase activity
GO:0043167	0.315	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.982	multicellular organismal process
GO:0035249	0.973	synaptic transmission, glutamatergic
GO:0050877	0.968	nervous system process
GO:0007611	0.963	learning or memory
GO:0050794	0.962	regulation of cellular process
GO:0080090	0.941	regulation of primary metabolic process
GO:0099177	0.938	regulation of trans-synaptic signaling
GO:0048699	0.935	generation of neurons
GO:0007632	0.933	visual behavior
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0044238	0.921	primary metabolic process
GO:0050804	0.921	modulation of chemical synaptic transmission
GO:0008542	0.919	visual learning
GO:0006807	0.910	nitrogen compound metabolic process
GO:0043170	0.904	macromolecule metabolic process
GO:0051246	0.904	regulation of protein metabolic process
GO:0043412	0.893	macromolecule modification
GO:0048167	0.882	regulation of synaptic plasticity
GO:1901564	0.864	organonitrogen compound metabolic process
GO:0019538	0.852	protein metabolic process
GO:0036211	0.707	protein modification process
GO:0061351	0.469	neural precursor cell proliferation
GO:0031323	0.465	regulation of cellular metabolic process
GO:0031399	0.454	regulation of protein modification process
GO:0001932	0.423	regulation of protein phosphorylation
GO:0007405	0.408	neuroblast proliferation
GO:0032446	0.400	protein modification by small protein conjugation
GO:0050730	0.395	regulation of peptidyl-tyrosine phosphorylation
GO:0016567	0.393	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0045202	0.982	synapse
GO:0048786	0.969	presynaptic active zone
GO:0009986	0.967	cell surface
GO:0098794	0.949	postsynapse
GO:0005622	0.721	intracellular anatomical structure
GO:0043226	0.590	organelle
GO:0005737	0.563	cytoplasm
GO:0043227	0.558	membrane-bounded organelle
GO:0043229	0.495	intracellular organelle
GO:0043231	0.450	intracellular membrane-bounded organelle
GO:0005634	0.350	nucleus
GO:0012505	0.311	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.993	Transferases.

[back to server]