StarFunc result for job id O43150

User Input

>input (1006 residues)
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43150	1.000	1.000	0.000	1006	1.000	1.000	O43150.pdb.gz	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
2	AFDB:Q9QWY8	0.380	0.338	6.605E-91	1147	0.608	0.534	Q9QWY8.pdb.gz	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
3	AFDB:A0A0B4LEF8	0.277	0.244	6.946E-70	1143	0.454	0.400	A0A0B4LEF8.pdb.gz	A0A0B4LEF8_DROME ArfGAP with SH3 domain, ankyrin repeat and PH domain, isoform D OS=Drosophila melanogaster OX=7227 GN=Asap PE=4 SV=1
4	PDB:3lvqE	0.244	0.572	1.858E-21	420	0.137	0.329	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
5	AFDB:X2JDY8	0.261	0.257	8.801E-19	1025	0.171	0.168	X2JDY8.pdb.gz	RHGF_DROME Rho GTPase-activating protein Graf OS=Drosophila melanogaster OX=7227 GN=Graf PE=1 SV=1
6	PDB:3ljuX	0.117	0.307	4.099E-7	373	0.040	0.107	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	AFDB:Q8CGF1	0.102	0.083	1.379E-6	1266	0.150	0.119	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
8	AFDB:O74345	0.116	0.191	4.202E-6	601	0.106	0.178	O74345.pdb.gz	UCP3_SCHPO UBA domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp3 PE=4 SV=1
9	PDB:3o47A	0.090	0.291	1.657E-5	289	0.059	0.204	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
10	AFDB:F4HXP0	0.118	0.181	2.186E-5	651	0.109	0.169	F4HXP0.pdb.gz	F4HXP0_ARATH ARF GAP-like zinc finger-containing protein ZIGA4 OS=Arabidopsis thaliana OX=3702 GN=ZIGA4 PE=1 SV=1
11	AFDB:Q54DW7	0.095	0.097	6.094E-5	986	0.161	0.164	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
12	AFDB:A0A0B4LFI1	0.149	0.139	1.137E-4	1089	0.118	0.109	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
13	AFDB:Q9UPS8	0.097	0.060	3.962E-4	1710	0.090	0.053	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
14	PDB:6jd6B	0.096	0.398	5.604E-4	192	0.030	0.156	6jd6B.pdb.gz
15	PDB:3ehqA	0.105	0.529	7.656E-4	182	0.036	0.198	3ehqA.pdb.gz
16	PDB:7rx9A	0.102	0.197	1.250E-3	432	0.064	0.148	7rx9A.pdb.gz
17	PDB:8cs9A	0.099	0.121	1.250E-3	796	0.038	0.048	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
18	PDB:2dybA	0.057	0.189	1.562E-3	298	0.020	0.067	2dybA.pdb.gz
19	PDB:4mt6A	0.083	0.201	1.562E-3	389	0.050	0.129	4mt6A.pdb.gz
20	PDB:6bbpA	0.081	0.149	1.867E-3	520	0.024	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LEF8	0.0	681	1143	0.371	0.326	A0A0B4LEF8_DROME ArfGAP with SH3 domain, ankyrin repeat and PH domain, isoform D OS=Drosophila melanogaster OX=7227 GN=Asap PE=4 SV=1
2	A1Z7A6	0.0	682	1155	0.385	0.335	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
3	O43150	0.0	2091	1006	1.000	1.000	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
4	O97902	0.0	1004	1129	0.517	0.461	ASAP1_BOVIN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Bos taurus OX=9913 GN=ASAP1 PE=1 SV=1
5	Q8TDY4	0.0	776	903	0.375	0.417	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1
6	Q9QWY8	0.0	1042	1147	0.600	0.527	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
7	Q9ULH1	0.0	1016	1129	0.520	0.463	ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4
8	Q6ZQK5	2.46e-46	181	770	0.150	0.196	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
9	Q5FVC7	4.13e-46	180	770	0.147	0.192	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
10	Q4QQN0	8.17e-46	177	626	0.135	0.217	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
11	A2ADA6	1.51e-45	179	829	0.134	0.163	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
12	Q6NXL5	2.01e-45	179	833	0.136	0.164	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
13	Q15057	2.99e-45	177	778	0.147	0.190	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
14	Q3UH98	5.42e-45	177	833	0.136	0.164	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q15027	1.34e-40	163	740	0.117	0.159	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
16	Q54WI0	4.13e-37	154	1333	0.157	0.119	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
17	Q9FIT8	4.94e-36	149	828	0.180	0.219	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
18	Q8T0R1	2.15e-33	140	767	0.117	0.154	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
19	Q9VCQ6	2.70e-33	140	828	0.117	0.143	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
20	Q8MSZ5	3.08e-30	122	235	0.066	0.281	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.2e-05	36.7	Ankyrin repeat
2	PF12796 Ank_2	7.9e-16	69.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.025	26.0	Ankyrin repeat
4	PF13637 Ank_4	0.0024	29.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.00017	33.1	Ankyrin repeats (many copies)
6	PF01412 ArfGap	5.4e-29	112.0	Putative GTPase activating protein for Arf
7	PF03114 BAR	0.0024	29.1	BAR domain
8	PF16746 BAR_3	5.6e-24	96.6	BAR domain of APPL family
9	PF00169 PH	1.2e-09	50.0	PH domain
10	PF16652 PH_13	12	17.3	Pleckstrin homology domain
11	PF15410 PH_9	6.1	18.5	Pleckstrin homology domain
12	PF00018 SH3_1	2.3e-06	38.4	SH3 domain
13	PF07653 SH3_2	9e-05	33.5	Variant SH3 domain
14	PF14604 SH3_9	2.1e-07	42.1	Variant SH3 domain
15	PF16764 Sharpin_PH	5.5e+02	11.8	Sharpin PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281419

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.963	ADP-ribosylation factor 1
2	9606.ENSP00000298316	0.962	ADP-ribosylation factor 6
3	9606.ENSP00000316779	0.933	Myc box-dependent-interacting protein 1
4	9606.ENSP00000357048	0.925	Coatomer subunit alpha
5	9606.ENSP00000400175	0.915	Transforming protein RhoA
6	9606.ENSP00000309415	0.914	Clathrin light chain B
7	9606.ENSP00000407586	0.913	GTPase HRas
8	9606.ENSP00000348461	0.912	Ras-related C3 botulinum toxin substrate 1
9	9606.ENSP00000242285	0.911	Clathrin light chain A
10	9606.ENSP00000386918	0.907	ER lumen protein-retaining receptor 3
11	9606.ENSP00000258739	0.904	ER lumen protein-retaining receptor 2
12	9606.ENSP00000329471	0.904	ER lumen protein-retaining receptor 1
13	9606.ENSP00000267257	0.843	Paxillin
14	9606.ENSP00000380638	0.840	Protein-tyrosine kinase 2-beta
15	9606.ENSP00000338769	0.829	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3
16	9606.ENSP00000380921	0.813	SH3 domain-containing kinase-binding protein 1
17	9606.ENSP00000429900	0.806	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
18	9606.ENSP00000348602	0.791	Amphiphysin
19	9606.ENSP00000264775	0.767	Phospholipid phosphatase 1
20	9606.ENSP00000329697	0.766	Phospholipid phosphatase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.588	molecular function regulator activity
GO:0030234	0.551	enzyme regulator activity
GO:0030695	0.465	GTPase regulator activity
GO:0008047	0.446	enzyme activator activity
GO:0005096	0.375	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0071840	0.715	cellular component organization or biogenesis
GO:0048518	0.681	positive regulation of biological process
GO:0051128	0.625	regulation of cellular component organization
GO:0048522	0.587	positive regulation of cellular process
GO:0016043	0.483	cellular component organization
GO:0050896	0.461	response to stimulus
GO:0048519	0.382	negative regulation of biological process
GO:0065008	0.315	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0030054	0.961	cell junction
GO:0043232	0.936	intracellular non-membrane-bounded organelle
GO:0016020	0.895	membrane
GO:0031982	0.883	vesicle
GO:0005634	0.769	nucleus
GO:0042995	0.610	cell projection
GO:0071944	0.599	cell periphery
GO:0005886	0.551	plasma membrane
GO:0031410	0.535	cytoplasmic vesicle
GO:0120025	0.515	plasma membrane bounded cell projection
GO:0012505	0.486	endomembrane system
GO:0031981	0.475	nuclear lumen
GO:0045202	0.362	synapse
GO:0005856	0.357	cytoskeleton
GO:0015629	0.353	actin cytoskeleton
GO:0031252	0.301	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]