StarFunc result for job id O43151

User Input

>input (1795 residues)
MSQFQVPLAVQPDLPGLYDFPQRQVMVGSFPGSGLSMAGSESQLRGGGDGRKKRKRCGTC
EPCRRLENCGACTSCTNRRTHQICKLRKCEVLKKKVGLLKEVEIKAGEGAGPWGQGAAVK
TGSELSPVDGPVPGQMDSGPVYHGDSRQLSASGVPVNGAREPAGPSLLGTGGPWRVDQKP
DWEAAPGPAHTARLEDAHDLVAFSAVAEAVSSYGALSTRLYETFNREMSREAGNNSRGPR
PGPEGCSAGSEDLDTLQTALALARHGMKPPNCNCDGPECPDYLEWLEGKIKSVVMEGGEE
RPRLPGPLPPGEAGLPAPSTRPLLSSEVPQISPQEGLPLSQSALSIAKEKNISLQTAIAI
EALTQLSSALPQPSHSTPQASCPLPEALSPPAPFRSPQSYLRAPSWPVVPPEEHSSFAPD
SSAFPPATPRTEFPEAWGTDTPPATPRSSWPMPRPSPDPMAELEQLLGSASDYIQSVFKR
PEALPTKPKVKVEAPSSSPAPAPSPVLQREAPTPSSEPDTHQKAQTALQQHLHHKRSLFL
EQVHDTSFPAPSEPSAPGWWPPPSSPVPRLPDRPPKEKKKKLPTPAGGPVGTEKAAPGIK
PSVRKPIQIKKSRPREAQPLFPPVRQIVLEGLRSPASQEVQAHPPAPLPASQGSAVPLPP
EPSLALFAPSPSRDSLLPPTQEMRSPSPMTALQPGSTGPLPPADDKLEELIRQFEAEFGD
SFGLPGPPSVPIQDPENQQTCLPAPESPFATRSPKQIKIESSGAVTVLSTTCFHSEEGGQ
EATPTKAENPLTPTLSGFLESPLKYLDTPTKSLLDTPAKRAQAEFPTCDCVEQIVEKDEG
PYYTHLGSGPTVASIRELMEERYGEKGKAIRIEKVIYTGKEGKSSRGCPIAKWVIRRHTL
EEKLLCLVRHRAGHHCQNAVIVILILAWEGIPRSLGDTLYQELTDTLRKYGNPTSRRCGL
NDDRTCACQGKDPNTCGASFSFGCSWSMYFNGCKYARSKTPRKFRLAGDNPKEEEVLRKS
FQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQ
HNLYNGCTVVCTLTKEDNRCVGKIPEDEQLHVLPLYKMANTDEFGSEENQNAKVGSGAIQ
VLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAGITSD
PGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSY
HSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPD
LHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLHSVSR
DPSPFAQSSNCYNRSIKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSG
GPSMSPKRTNGVGGSWGVFSSGESPAIVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQA
ASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKLWNPM
KGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKG
AVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAPAHGSILIECARRELHATTPLKK
PNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQEAKLY
GKKRKWGGTVVAEPQQKEKKGVVPTRQALAVPTDSAVTVSSYAYTKVTGPYSRWI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43151	1.000	1.000	0.000	1795	1.000	1.000	O43151.pdb.gz	TET3_HUMAN Methylcytosine dioxygenase TET3 OS=Homo sapiens OX=9606 GN=TET3 PE=1 SV=4
2	AFDB:Q8BG87	0.408	0.407	0.000	1803	0.896	0.892	Q8BG87.pdb.gz	TET3_MOUSE Methylcytosine dioxygenase TET3 OS=Mus musculus OX=10090 GN=Tet3 PE=1 SV=4
3	AFDB:F1R3C6	0.292	0.283	6.841E-91	1855	0.321	0.311	F1R3C6.pdb.gz	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
4	AFDB:E7F958	0.262	0.273	5.920E-90	1715	0.295	0.308	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
5	AFDB:Q6N021	0.283	0.256	4.143E-86	2002	0.326	0.292	Q6N021.pdb.gz	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
6	AFDB:D4AC33	0.265	0.249	2.710E-80	1920	0.286	0.268	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
7	AFDB:Q4JK59	0.254	0.239	4.404E-78	1912	0.286	0.269	Q4JK59.pdb.gz	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
8	AFDB:Q8NFU7	0.261	0.223	8.740E-77	2136	0.295	0.248	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
9	AFDB:Q3URK3	0.259	0.234	1.073E-69	2007	0.293	0.262	Q3URK3.pdb.gz	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
10	AFDB:F4IZM8	0.034	0.041	1.281E-4	1347	0.115	0.153	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
11	PDB:4lt5A	0.088	0.480	3.230E-2	265	0.014	0.094	4lt5A.pdb.gz	Structure of a Naegleria Tet-like dioxygenase in complex with 5-methylcytosine DNA.
12	PDB:7cy6A	0.081	0.155	5.618E-2	872	0.013	0.026	7cy6A.pdb.gz	Molecular mechanism for vitamin C-derived C 5 -glyceryl-methylcytosine DNA modification catalyzed by algal TET homologue CMD1.
13	PDB:4ie6A	0.072	0.232	1.699E-1	447	0.019	0.078	4ie6A.pdb.gz	Structural basis for inhibition of the fat mass and obesity associated protein (FTO)
14	PDB:6f2eA	0.027	0.126	1.055	329	0.006	0.033	6f2eA.pdb.gz
15	PDB:5ybnA	0.052	0.227	1.642	296	0.014	0.088	5ybnA.pdb.gz	Structure function and engineering of multifunctional non-heme iron dependent oxygenases in fungal meroterpenoid biosynthesis.
16	PDB:3o2gA	0.028	0.116	3.019	386	0.005	0.023	3o2gA.pdb.gz	Structural and mechanistic studies on gamma-butyrobetaine hydroxylase.
17	PDB:7cl4F	0.020	0.102	3.372	285	0.004	0.025	7cl4F.pdb.gz
18	PDB:6euoC	0.019	0.090	4.700	354	0.004	0.020	6euoC.pdb.gz	Structural Studies based on two Lysine Dioxygenases with Distinct Regioselectivity Brings Insights Into Enzyme Specificity within the Clavaminate Synthase-Like Family.
19	PDB:2rdnA	0.023	0.114	4.967	275	0.008	0.055	2rdnA.pdb.gz	Crystal Structure of the Non-heme Iron Dioxygenase PtlH in Pentalenolactone Biosynthesis.
20	PDB:1jr7A	0.023	0.119	5.548	306	0.006	0.036	1jr7A.pdb.gz	Structural genomics: a pipeline for providing structures for the biologist.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q4R6	0.0	763	2052	0.222	0.194	A0A2R8Q4R6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=si:ch211-220a11.1 PE=1 SV=1
2	E7EQS8	0.0	617	2023	0.167	0.148	E7EQS8_HUMAN Methylcytosine dioxygenase TET OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=1
3	F1R3C6	0.0	641	1855	0.167	0.161	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
4	O43151	0.0	3651	1795	1.000	1.000	TET3_HUMAN Methylcytosine dioxygenase TET3 OS=Homo sapiens OX=9606 GN=TET3 PE=1 SV=4
5	Q6N021	0.0	617	2002	0.167	0.149	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
6	Q8BG87	0.0	3165	1803	0.897	0.893	TET3_MOUSE Methylcytosine dioxygenase TET3 OS=Mus musculus OX=10090 GN=Tet3 PE=1 SV=4
7	E7F958	1.74e-177	585	1715	0.154	0.161	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
8	Q8NFU7	2.90e-150	514	2136	0.157	0.132	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
9	D4AC33	3.06e-144	494	1920	0.143	0.134	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
10	Q3URK3	3.69e-144	495	2007	0.152	0.136	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
11	Q4JK59	2.26e-133	462	1912	0.131	0.123	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
12	M9NEY8	1.51e-110	395	2860	0.105	0.066	TET_DROME Methylcytosine dioxygenase TET OS=Drosophila melanogaster OX=7227 GN=Tet PE=1 SV=1
13	Q0VFP6	4.63e-16	80.5	188	0.021	0.197	CXXC4_XENTR CXXC-type zinc finger protein 4 OS=Xenopus tropicalis OX=8364 GN=cxxc4 PE=2 SV=2
14	Q7LFL8	7.73e-15	80.1	322	0.026	0.146	CXXC5_HUMAN CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1
15	Q6NXI8	1.07e-14	76.6	198	0.019	0.177	CXXC4_MOUSE CXXC-type zinc finger protein 4 OS=Mus musculus OX=10090 GN=Cxxc4 PE=2 SV=1
16	Q9EQC9	1.07e-14	76.6	198	0.019	0.177	CXXC4_RAT CXXC-type zinc finger protein 4 OS=Rattus norvegicus OX=10116 GN=Cxxc4 PE=1 SV=1
17	Q9H2H0	1.07e-14	76.6	198	0.019	0.177	CXXC4_HUMAN CXXC-type zinc finger protein 4 OS=Homo sapiens OX=9606 GN=CXXC4 PE=1 SV=1
18	E7FC24	3.24e-14	77.4	283	0.028	0.180	E7FC24_DANRE CXXC finger protein 5a OS=Danio rerio OX=7955 GN=cxxc5a PE=4 SV=1
19	Q7SZE4	1.85e-04	48.5	563	0.013	0.041	Q7SZE4_DANRE CXXC-type zinc finger protein 1 OS=Danio rerio OX=7955 GN=cxxc1 PE=1 SV=1
20	Q6PGZ4	0.001	45.8	570	0.013	0.042	Q6PGZ4_DANRE CXXC-type zinc finger protein 1 OS=Danio rerio OX=7955 GN=cxxc1l PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12851 Tet_JBP	2.1e-101	351.3	Oxygenase domain of the 2OGFeDO superfamily
2	PF02008 zf-CXXC	0.0038	28.5	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362824	0.950	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
2	9606.ENSP00000378402	0.898	Paired amphipathic helix protein Sin3a
3	9606.ENSP00000352516	0.856	DNA (cytosine-5)-methyltransferase 1
4	9606.ENSP00000376611	0.855	G/T mismatch-specific thymine DNA glycosylase
5	9606.ENSP00000442788	0.802	Methylcytosine dioxygenase TET2
6	9606.ENSP00000319169	0.786	Protein arginine N-methyltransferase 5
7	9606.ENSP00000264709	0.781	DNA (cytosine-5)-methyltransferase 3A
8	9606.ENSP00000328547	0.769	DNA (cytosine-5)-methyltransferase 3B
9	9606.ENSP00000313983	0.744	Histone-lysine N-methyltransferase NSD3
10	9606.ENSP00000229307	0.720	Homeobox protein NANOG
11	9606.ENSP00000362748	0.707	Methylcytosine dioxygenase TET1
12	9606.ENSP00000309555	0.695	Host cell factor 1
13	9606.ENSP00000270172	0.657	DNA (cytosine-5)-methyltransferase 3-like
14	9606.ENSP00000362179	0.654	Endoribonuclease ZC3H12A
15	9606.ENSP00000339250	0.645	Developmental pluripotency-associated protein 3
16	9606.ENSP00000390475	0.638	CXXC-type zinc finger protein 1
17	9606.ENSP00000362649	0.619	Histone deacetylase 1
18	9606.ENSP00000479617	0.616	E3 ubiquitin-protein ligase UHRF1
19	9606.ENSP00000320147	0.609	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000395535	0.589	Methyl-CpG-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016706	0.999	2-oxoglutarate-dependent dioxygenase activity
GO:0008270	0.998	zinc ion binding
GO:0008327	0.996	methyl-CpG binding
GO:0070579	0.923	methylcytosine dioxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.992	primary metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0043412	0.984	macromolecule modification
GO:0019222	0.976	regulation of metabolic process
GO:0044260	0.974	cellular macromolecule metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0048518	0.932	positive regulation of biological process
GO:0019219	0.929	regulation of nucleobase-containing compound metabolic process
GO:1903506	0.915	regulation of nucleic acid-templated transcription
GO:0006355	0.914	regulation of DNA-templated transcription
GO:0048522	0.904	positive regulation of cellular process
GO:0009893	0.904	positive regulation of metabolic process
GO:0010604	0.887	positive regulation of macromolecule metabolic process
GO:0036211	0.878	protein modification process
GO:0006357	0.838	regulation of transcription by RNA polymerase II
GO:0051173	0.836	positive regulation of nitrogen compound metabolic process
GO:0031325	0.828	positive regulation of cellular metabolic process
GO:0045935	0.821	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.810	positive regulation of macromolecule biosynthetic process
GO:0045893	0.803	positive regulation of DNA-templated transcription
GO:0070085	0.737	glycosylation
GO:1901360	0.717	organic cyclic compound metabolic process
GO:0006725	0.657	cellular aromatic compound metabolic process
GO:0090304	0.630	nucleic acid metabolic process
GO:0045944	0.611	positive regulation of transcription by RNA polymerase II
GO:0006304	0.562	DNA modification
GO:0070988	0.491	demethylation
GO:0032259	0.439	methylation
GO:0032502	0.412	developmental process
GO:0048856	0.398	anatomical structure development
GO:0050896	0.372	response to stimulus
GO:1901576	0.363	organic substance biosynthetic process
GO:0044249	0.363	cellular biosynthetic process
GO:1901135	0.361	carbohydrate derivative metabolic process
GO:0006486	0.347	protein glycosylation
GO:0006493	0.343	protein O-linked glycosylation
GO:0032501	0.310	multicellular organismal process
GO:0048519	0.306	negative regulation of biological process
GO:0048523	0.304	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0045120	0.973	pronucleus
GO:0005829	0.800	cytosol
GO:0001940	0.699	male pronucleus
GO:0001939	0.699	female pronucleus
GO:0032991	0.422	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.999	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:52636	0.923	2-oxoglutarate + a 5-methyl-2'-deoxycytidine in DNA + O2 = a 5-hydroxymethyl-2'-deoxycytidine in DNA + CO2 + succinate
EC:1.14.11.n2	0.923	Transferred entry: 1.14.11.80.

[back to server]