StarFunc result for job id O43155

User Input

>input (660 residues)
MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRN
SLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPP
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSP
FLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43155	1.000	1.000	7.915E-104	660	1.000	1.000	O43155.pdb.gz	FLRT2_HUMAN Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens OX=9606 GN=FLRT2 PE=1 SV=1
2	AFDB:B1H234	0.569	0.577	2.656E-62	649	0.458	0.465	B1H234.pdb.gz	FLRT3_RAT Leucine-rich repeat transmembrane protein FLRT3 OS=Rattus norvegicus OX=10116 GN=Flrt3 PE=1 SV=1
3	AFDB:Q70AK3	0.507	0.517	6.405E-61	648	0.459	0.468	Q70AK3.pdb.gz	FLRT3_XENLA Leucine-rich repeat transmembrane protein FLRT3 OS=Xenopus laevis OX=8355 GN=flrt3 PE=1 SV=2
4	AFDB:B8A507	0.531	0.539	4.069E-59	649	0.455	0.462	B8A507.pdb.gz	B8A507_DANRE Fibronectin leucine-rich transmembrane 3 OS=Danio rerio OX=7955 GN=fb93g11 PE=1 SV=1
5	AFDB:Q6RKD8	0.646	0.659	2.697E-58	646	0.429	0.438	Q6RKD8.pdb.gz	FLRT1_MOUSE Leucine-rich repeat transmembrane protein FLRT1 OS=Mus musculus OX=10090 GN=Flrt1 PE=1 SV=2
6	AFDB:F1QF54	0.504	0.466	5.773E-52	715	0.394	0.364	F1QF54.pdb.gz	F1QF54_DANRE Fibronectin leucine-rich transmembrane protein 1b OS=Danio rerio OX=7955 GN=flrt1b PE=1 SV=2
7	AFDB:A8BBF0	0.487	0.574	5.863E-48	558	0.332	0.392	A8BBF0.pdb.gz
8	AFDB:A8DZ86	0.439	0.422	5.046E-27	688	0.253	0.243	A8DZ86.pdb.gz	A8DZ86_DANRE Vasorin a OS=Danio rerio OX=7955 GN=id:ibd2098 PE=1 SV=1
9	AFDB:Q6EMK4	0.453	0.446	4.022E-26	673	0.242	0.238	Q6EMK4.pdb.gz	VASN_HUMAN Vasorin OS=Homo sapiens OX=9606 GN=VASN PE=1 SV=1
10	AFDB:Q9CZT5	0.445	0.438	7.024E-25	673	0.253	0.248	Q9CZT5.pdb.gz	VASN_MOUSE Vasorin OS=Mus musculus OX=10090 GN=Vasn PE=2 SV=2
11	PDB:1xcdA	0.347	0.715	2.366E-12	305	0.105	0.226	1xcdA.pdb.gz
12	PDB:2ft3F	0.284	0.567	3.945E-11	305	0.121	0.262	2ft3F.pdb.gz
13	PDB:5yq5B	0.372	0.767	6.257E-11	306	0.123	0.265	5yq5B.pdb.gz
14	PDB:7tvfD	0.325	0.402	9.513E-10	515	0.114	0.146	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
15	PDB:7wv3A	0.316	0.313	2.506E-9	668	0.129	0.127	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
16	PDB:3t6qA	0.179	0.193	6.603E-9	601	0.120	0.131	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:5y31B	0.161	0.203	2.403E-8	511	0.098	0.127	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
18	PDB:7wrqA	0.254	0.283	2.516E-8	566	0.121	0.141	7wrqA.pdb.gz
19	PDB:6gffI	0.266	0.310	8.348E-8	551	0.112	0.134	6gffI.pdb.gz
20	PDB:3b2dA	0.158	0.170	1.324E-7	601	0.123	0.135	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1H234	0.0	587	649	0.462	0.470	FLRT3_RAT Leucine-rich repeat transmembrane protein FLRT3 OS=Rattus norvegicus OX=10116 GN=Flrt3 PE=1 SV=1
2	B8A507	0.0	589	649	0.464	0.471	B8A507_DANRE Fibronectin leucine-rich transmembrane 3 OS=Danio rerio OX=7955 GN=fb93g11 PE=1 SV=1
3	O43155	0.0	1365	660	1.000	1.000	FLRT2_HUMAN Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens OX=9606 GN=FLRT2 PE=1 SV=1
4	Q6RKD8	0.0	548	646	0.438	0.447	FLRT1_MOUSE Leucine-rich repeat transmembrane protein FLRT1 OS=Mus musculus OX=10090 GN=Flrt1 PE=1 SV=2
5	Q70AK3	0.0	571	648	0.465	0.474	FLRT3_XENLA Leucine-rich repeat transmembrane protein FLRT3 OS=Xenopus laevis OX=8355 GN=flrt3 PE=1 SV=2
6	Q8BGT1	0.0	583	649	0.461	0.468	FLRT3_MOUSE Leucine-rich repeat transmembrane protein FLRT3 OS=Mus musculus OX=10090 GN=Flrt3 PE=1 SV=1
7	Q8BLU0	0.0	1328	660	0.973	0.973	FLRT2_MOUSE Leucine-rich repeat transmembrane protein FLRT2 OS=Mus musculus OX=10090 GN=Flrt2 PE=1 SV=1
8	Q9NZU0	0.0	585	649	0.462	0.470	FLRT3_HUMAN Leucine-rich repeat transmembrane protein FLRT3 OS=Homo sapiens OX=9606 GN=FLRT3 PE=1 SV=1
9	Q9NZU1	0.0	549	646	0.439	0.449	FLRT1_HUMAN Leucine-rich repeat transmembrane protein FLRT1 OS=Homo sapiens OX=9606 GN=FLRT1 PE=1 SV=3
10	F1QF54	3.34e-120	376	715	0.270	0.249	F1QF54_DANRE Fibronectin leucine-rich transmembrane protein 1b OS=Danio rerio OX=7955 GN=flrt1b PE=1 SV=2
11	Q6P3Y9	2.25e-28	122	559	0.126	0.148	PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus OX=10090 GN=Podnl1 PE=1 SV=3
12	Q9HCJ2	3.94e-28	122	640	0.138	0.142	LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1
13	P22792	4.91e-28	121	545	0.180	0.218	CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens OX=9606 GN=CPN2 PE=1 SV=3
14	Q99PH1	8.33e-28	121	652	0.145	0.147	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
15	Q8C031	8.36e-28	121	640	0.136	0.141	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
16	Q9HBW1	9.39e-28	120	653	0.145	0.147	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
17	Q45R42	2.46e-27	119	652	0.144	0.146	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
18	Q8R5M3	6.36e-27	118	578	0.167	0.190	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
19	Q8TF66	7.75e-27	117	581	0.162	0.184	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
20	Q9BXN1	1.41e-26	114	380	0.115	0.200	ASPN_HUMAN Asporin OS=Homo sapiens OX=9606 GN=ASPN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.024	26.3	Fibronectin type III domain
2	PF01463 LRRCT	2.1	20.1	Leucine rich repeat C-terminal domain
3	PF01462 LRRNT	0.42	21.6	Leucine rich repeat N-terminal domain
4	PF00560 LRR_1	12	17.6	Leucine Rich Repeat
5	PF12799 LRR_4	2.6e-13	61.1	Leucine Rich repeats (2 copies)
6	PF13306 LRR_5	2.6e-07	42.1	BspA type Leucine rich repeat region (6 copies)
7	PF13516 LRR_6	26	16.2	Leucine Rich repeat
8	PF13855 LRR_8	1.5e-28	109.6	Leucine rich repeat
9	PF14580 LRR_9	0.33	22.0	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332879

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385143	0.974	Netrin receptor UNC5D
2	9606.ENSP00000422533	0.916	Adhesion G protein-coupled receptor L3
3	9606.ENSP00000393312	0.722	Fibroblast growth factor receptor 1
4	9606.ENSP00000334329	0.635	Netrin receptor UNC5B
5	9606.ENSP00000352414	0.634	Fibroblast growth factor 17
6	9606.ENSP00000371790	0.632	Fibroblast growth factor 9
7	9606.ENSP00000261304	0.627	Galactocerebrosidase
8	9606.ENSP00000264498	0.622	Fibroblast growth factor 2
9	9606.ENSP00000321797	0.621	Fibroblast growth factor 8
10	9606.ENSP00000264664	0.619	Fibroblast growth factor 10
11	9606.ENSP00000228837	0.617	Fibroblast growth factor 6
12	9606.ENSP00000237837	0.614	Fibroblast growth factor 23
13	9606.ENSP00000215530	0.612	Fibroblast growth factor 22
14	9606.ENSP00000480791	0.612	Fibroblast growth factor 1
15	9606.ENSP00000311697	0.611	Fibroblast growth factor 5
16	9606.ENSP00000264187	0.609	Nidogen-1
17	9606.ENSP00000369442	0.603	Klotho
18	9606.ENSP00000180166	0.602	Fibroblast growth factor 20
19	9606.ENSP00000168712	0.600	Fibroblast growth factor 4
20	9606.ENSP00000334122	0.600	Fibroblast growth factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.522	identical protein binding
GO:0005102	0.428	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050896	0.985	response to stimulus
GO:0048856	0.985	anatomical structure development
GO:0050794	0.981	regulation of cellular process
GO:0032501	0.979	multicellular organismal process
GO:0007275	0.960	multicellular organism development
GO:0048731	0.951	system development
GO:0071840	0.942	cellular component organization or biogenesis
GO:0009653	0.941	anatomical structure morphogenesis
GO:0016043	0.918	cellular component organization
GO:0048869	0.910	cellular developmental process
GO:0048518	0.895	positive regulation of biological process
GO:0030154	0.858	cell differentiation
GO:0007399	0.851	nervous system development
GO:0000902	0.817	cell morphogenesis
GO:0051716	0.771	cellular response to stimulus
GO:0051239	0.754	regulation of multicellular organismal process
GO:0031175	0.736	neuron projection development
GO:0048522	0.731	positive regulation of cellular process
GO:0007165	0.720	signal transduction
GO:0032989	0.695	cellular component morphogenesis
GO:0070848	0.544	response to growth factor
GO:0040011	0.540	locomotion
GO:0050793	0.536	regulation of developmental process
GO:0007166	0.510	cell surface receptor signaling pathway
GO:0008543	0.476	fibroblast growth factor receptor signaling pathway
GO:0032990	0.459	cell part morphogenesis
GO:0120039	0.436	plasma membrane bounded cell projection morphogenesis
GO:0048812	0.427	neuron projection morphogenesis
GO:0042221	0.416	response to chemical
GO:0051094	0.401	positive regulation of developmental process
GO:1901888	0.398	regulation of cell junction assembly
GO:0000904	0.338	cell morphogenesis involved in differentiation
GO:0048513	0.320	animal organ development
GO:2000026	0.318	regulation of multicellular organismal development
GO:0009605	0.316	response to external stimulus
GO:0051240	0.314	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.961	extracellular region
GO:0030054	0.864	cell junction
GO:0005615	0.852	extracellular space
GO:0043226	0.831	organelle
GO:0043227	0.692	membrane-bounded organelle
GO:0070161	0.632	anchoring junction
GO:0030055	0.500	cell-substrate junction
GO:0005925	0.467	focal adhesion
GO:0031982	0.382	vesicle
GO:0005622	0.302	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]