StarFunc result for job id O43157

User Input

>input (2135 residues)
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
RGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRP
SATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGL
WELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLE
VVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLY
DCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTG
PVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGA
TAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVG
DQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT
KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSS
QQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTL
QPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPP
VEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLL
ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
SGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLL
REDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDP
RTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRE
NQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLT
RLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNS
LPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYAR
DIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD
QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43157	1.000	1.000	0.000	2135	1.000	1.000	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
2	AFDB:Q8CJH3	0.762	0.768	0.000	2119	0.866	0.873	Q8CJH3.pdb.gz	PLXB1_MOUSE Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 SV=2
3	AFDB:F1QZQ3	0.274	0.694	9.603E-86	812	0.289	0.759	F1QZQ3.pdb.gz
4	PDB:6vxkB	0.182	0.482	2.328E-20	747	0.076	0.217	6vxkB.pdb.gz
5	PDB:6qp7A	0.174	0.538	9.551E-20	620	0.046	0.160	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
6	PDB:3nvqA	0.172	0.553	4.017E-16	588	0.052	0.187	3nvqA.pdb.gz
7	PDB:5e7gA	0.059	0.200	3.312E-6	446	0.024	0.117	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
8	PDB:7q5zA	0.055	0.070	5.922E-6	1344	0.025	0.039	7q5zA.pdb.gz
9	AFDB:Q9VGW1	0.048	0.051	8.753E-6	1943	0.034	0.037	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
10	PDB:7q1yA	0.048	0.065	1.358E-5	1374	0.039	0.060	7q1yA.pdb.gz
11	PDB:4aq1A	0.044	0.087	4.528E-5	721	0.032	0.094	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	AFDB:Q3V1M1	0.065	0.057	5.217E-5	2594	0.050	0.041	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
13	PDB:5oj2B	0.069	0.134	6.311E-5	692	0.028	0.085	5oj2B.pdb.gz
14	PDB:7mq8LN	0.101	0.286	6.579E-5	671	0.027	0.086	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6h03A	0.059	0.081	1.129E-4	1223	0.028	0.049	6h03A.pdb.gz
16	AFDB:Q6NYV7	0.054	0.092	1.356E-4	1001	0.037	0.080	Q6NYV7.pdb.gz	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
17	AFDB:O14917	0.046	0.069	4.518E-4	1159	0.035	0.065	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
18	AFDB:Q9VYK6	0.086	0.118	2.583E-3	1470	0.096	0.139	Q9VYK6.pdb.gz	Q9VYK6_DROME Tomosyn, isoform C OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=3
19	AFDB:P79987	0.108	0.205	1.251E-2	1019	0.055	0.115	P79987.pdb.gz	HIRA_CHICK Protein HIRA OS=Gallus gallus OX=9031 GN=HIRA PE=1 SV=2
20	AFDB:Q9Y6Q2	0.042	0.084	1.251E-2	735	0.047	0.136	Q9Y6Q2.pdb.gz	STON1_HUMAN Stonin-1 OS=Homo sapiens OX=9606 GN=STON1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	792	1902	0.229	0.257	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	773	1885	0.227	0.257	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	757	1892	0.218	0.246	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	1021	1842	0.263	0.305	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	943	1864	0.251	0.288	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	1250	1902	0.323	0.363	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	1664	2220	0.392	0.377	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	947	1864	0.260	0.298	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	796	1928	0.216	0.240	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	1009	1838	0.261	0.304	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	4359	2135	1.000	1.000	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	794	1894	0.227	0.256	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	785	1945	0.216	0.238	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	752	1871	0.221	0.252	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	811	1894	0.235	0.265	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	793	1894	0.227	0.256	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	755	1872	0.220	0.251	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	788	1505	0.217	0.308	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	768	1925	0.218	0.242	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	667	1945	0.195	0.214	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08337 Plexin_cytopl	1.4e-177	602.7	Plexin cytoplasmic RasGAP domain
2	PF20170 Plexin_RBD	2.4e-37	138.9	Plexin cytoplasmic RhoGTPase-binding domain
3	PF01437 PSI	2.6e-15	68.0	Plexin repeat
4	PF01403 Sema	1.5e-22	91.8	Sema domain
5	PF01833 TIG	6.3e-33	124.1	IPT/TIG domain
6	PF18020 TIG_2	7.3e-19	79.5	TIG domain found in plexin
7	PF17960 TIG_plexin	2.1e-16	70.9	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308461	0.999	Rho-related GTP-binding protein Rho6
2	9606.ENSP00000416523	0.999	Semaphorin-4D
3	9606.ENSP00000357177	0.998	Rho guanine nucleotide exchange factor 11
4	9606.ENSP00000380942	0.995	Rho guanine nucleotide exchange factor 12
5	9606.ENSP00000269571	0.991	Receptor tyrosine-protein kinase erbB-2
6	9606.ENSP00000246792	0.983	Ras-related protein R-Ras
7	9606.ENSP00000304283	0.973	Ras-related C3 botulinum toxin substrate 3
8	9606.ENSP00000400175	0.973	Transforming protein RhoA
9	9606.ENSP00000317272	0.957	Hepatocyte growth factor receptor
10	9606.ENSP00000484146	0.955	Semaphorin-3B
11	9606.ENSP00000350547	0.952	Semaphorin-4F
12	9606.ENSP00000002829	0.949	Semaphorin-3F
13	9606.ENSP00000265361	0.941	Semaphorin-3C
14	9606.ENSP00000265371	0.940	Neuropilin-1
15	9606.ENSP00000466680	0.929	Rho-related GTP-binding protein RhoN
16	9606.ENSP00000285735	0.928	Rho-related GTP-binding protein RhoC
17	9606.ENSP00000272233	0.923	Rho-related GTP-binding protein RhoB
18	9606.ENSP00000261918	0.913	Semaphorin-7A
19	9606.ENSP00000353582	0.913	Neuropilin-2
20	9606.ENSP00000308576	0.905	Rho-related GTP-binding protein RhoD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017154	1.000	semaphorin receptor activity
GO:0098772	0.956	molecular function regulator activity
GO:0005102	0.936	signaling receptor binding
GO:0140677	0.918	molecular function activator activity
GO:0030215	0.848	semaphorin receptor binding
GO:0030234	0.795	enzyme regulator activity
GO:0030695	0.775	GTPase regulator activity
GO:0005096	0.761	GTPase activator activity
GO:0032794	0.306	GTPase activating protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0023052	0.978	signaling
GO:0007154	0.978	cell communication
GO:0051716	0.968	cellular response to stimulus
GO:0048523	0.937	negative regulation of cellular process
GO:0007165	0.926	signal transduction
GO:0022603	0.913	regulation of anatomical structure morphogenesis
GO:0071526	0.866	semaphorin-plexin signaling pathway
GO:0051128	0.865	regulation of cellular component organization
GO:0032502	0.693	developmental process
GO:0048518	0.661	positive regulation of biological process
GO:0030155	0.647	regulation of cell adhesion
GO:0071840	0.638	cellular component organization or biogenesis
GO:0048856	0.636	anatomical structure development
GO:0032501	0.634	multicellular organismal process
GO:0022604	0.630	regulation of cell morphogenesis
GO:0048522	0.625	positive regulation of cellular process
GO:0007275	0.610	multicellular organism development
GO:0008360	0.608	regulation of cell shape
GO:0048731	0.603	system development
GO:0016043	0.598	cellular component organization
GO:0009653	0.483	anatomical structure morphogenesis
GO:0048869	0.348	cellular developmental process
GO:0023051	0.310	regulation of signaling
GO:0048583	0.306	regulation of response to stimulus
GO:0010646	0.303	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.986	protein-containing complex
GO:0043226	0.728	organelle
GO:0043227	0.719	membrane-bounded organelle
GO:0043235	0.709	receptor complex
GO:0005737	0.705	cytoplasm
GO:0043231	0.580	intracellular membrane-bounded organelle
GO:0002116	0.393	semaphorin receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]