StarFunc result for job id O43159

User Input

>input (456 residues)
MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAASLSQHPPSLC
ISDSEEEEEERKKKCPKKASFASASAEVGKKGKKKCQKQGPPCSDSEEEVERKKKCHKQA
LVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPP
HTLSRKQWRNRQKNKRRCKNKFQPPQVPDQAPAEAPTEKTEVSPVPRTDSHEARAGALRA
RMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIA
RDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVA
VFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLT
NSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYKRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43159	1.000	1.000	2.208E-73	456	1.000	1.000	O43159.pdb.gz	RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2
2	PDB:7vkkA	0.256	0.396	7.001E-7	287	0.105	0.167	7vkkA.pdb.gz
3	PDB:3a25A	0.225	0.358	5.845E-6	264	0.059	0.102	3a25A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
4	PDB:7ezgA	0.236	0.367	5.845E-6	275	0.090	0.149	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
5	PDB:1p91A	0.243	0.384	6.200E-6	268	0.090	0.153	1p91A.pdb.gz	Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.
6	PDB:4f86A	0.254	0.409	1.258E-5	275	0.064	0.105	4f86A.pdb.gz	Structure analysis of geranyl pyrophosphate methyltransferase and the proposed reaction mechanism of SAM-dependent C-methylation
7	PDB:1qzzA	0.284	0.366	1.334E-5	340	0.096	0.129	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
8	PDB:2pwyA	0.240	0.412	1.415E-5	251	0.061	0.112	2pwyA.pdb.gz	Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
9	PDB:7wttq	0.227	0.411	1.415E-5	235	0.066	0.128	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
10	PDB:3a27A	0.218	0.404	1.791E-5	219	0.059	0.123	3a27A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
11	PDB:1i9gA	0.237	0.390	2.268E-5	264	0.070	0.121	1i9gA.pdb.gz	Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
12	AFDB:Q6NPR7	0.251	0.159	1.611E-4	770	0.178	0.105	Q6NPR7.pdb.gz	PMTO_ARATH Probable methyltransferase PMT24 OS=Arabidopsis thaliana OX=3702 GN=At1g29470 PE=2 SV=1
13	AFDB:Q9LN50	0.265	0.175	5.893E-4	724	0.156	0.098	Q9LN50.pdb.gz	PMTS_ARATH Probable methyltransferase PMT28 OS=Arabidopsis thaliana OX=3702 GN=At1g19430 PE=2 SV=1
14	AFDB:Q9SDQ3	0.163	0.132	7.404E-2	593	0.125	0.096	Q9SDQ3.pdb.gz	SCL1_ARATH Scarecrow-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=SCL1 PE=2 SV=1
15	AFDB:Q9CAN3	0.168	0.123	2.009	658	0.158	0.109	Q9CAN3.pdb.gz	SCL28_ARATH Scarecrow-like protein 28 OS=Arabidopsis thaliana OX=3702 GN=SCL28 PE=1 SV=1
16	AFDB:F4JCU0	0.071	0.037	3.220	1007	0.075	0.034	F4JCU0.pdb.gz	SUA_ARATH SUPPRESSOR OF ABI3-5 OS=Arabidopsis thaliana OX=3702 GN=SUA PE=1 SV=2
17	AFDB:Q9N658	0.079	0.070	3.416	541	0.099	0.083	Q9N658.pdb.gz	GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster OX=7227 GN=sens PE=1 SV=1
18	AFDB:O74412	0.090	0.051	3.843	963	0.075	0.035	O74412.pdb.gz	CBF12_SCHPO Transcription factor cbf12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cbf12 PE=2 SV=1
19	AFDB:O14336	0.070	0.069	4.076	461	0.094	0.093	O14336.pdb.gz	MUG80_SCHPO Meiotically up-regulated gene 80 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug80 PE=1 SV=1
20	AFDB:Q8GZV6	0.105	0.071	4.865	776	0.103	0.061	Q8GZV6.pdb.gz	Q8GZV6_ORYSJ BHLH domain-containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=OJ1017C11.10 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43159	0.0	932	456	1.000	1.000	RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2
2	Q10257	3.05e-64	211	318	0.237	0.340	RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp8 PE=3 SV=1
3	P38961	3.84e-45	163	392	0.257	0.298	RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP8 PE=1 SV=2
4	Q4GZA6	5.72e-43	157	369	0.228	0.282	Q4GZA6_TRYB2 Ribosomal RNA-processing protein 8 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1120 PE=3 SV=1
5	Q9P272	0.006	41.2	454	0.079	0.079	TRM9B_HUMAN Probable tRNA methyltransferase 9B OS=Homo sapiens OX=9606 GN=TRMT9B PE=2 SV=3
6	Q94A09	0.032	38.9	404	0.086	0.097	TRM9_ARATH tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM9 PE=1 SV=1
7	Q5HYK3	0.041	38.5	327	0.055	0.076	COQ5_HUMAN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2
8	Q9CXI0	0.050	38.1	327	0.057	0.080	COQ5_MOUSE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq5 PE=1 SV=2
9	Q80Y20	0.13	37.4	664	0.075	0.051	ALKB8_MOUSE Alkylated DNA repair protein alkB homolog 8 OS=Mus musculus OX=10090 GN=Alkbh8 PE=1 SV=1
10	Q6UX53	0.22	35.8	244	0.079	0.148	TMT1B_HUMAN Thiol S-methyltransferase TMT1B OS=Homo sapiens OX=9606 GN=TMT1B PE=1 SV=2
11	O06190	0.25	35.8	273	0.064	0.106	O06190_MYCTO Methyltransferase type 11 domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2697 PE=4 SV=1
12	Q83WC3	0.31	35.4	277	0.072	0.119	SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica OX=72020 PE=1 SV=1
13	Q9TYP1	0.46	35.0	334	0.042	0.057	STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans OX=6239 GN=strm-1 PE=1 SV=2
14	Q7U4Z9	0.56	34.7	280	0.061	0.100	SDMT_PARMW Dimethylglycine N-methyltransferase OS=Parasynechococcus marenigrum (strain WH8102) OX=84588 GN=bsmB PE=1 SV=1
15	P9WIN3	0.58	34.7	270	0.079	0.133	PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2952 PE=1 SV=1
16	Q9NIW4	0.77	35.0	1485	0.059	0.018	TRA2_CAERE Sex-determining transformer protein 2 OS=Caenorhabditis remanei OX=31234 GN=tra-2 PE=1 SV=1
17	Q9UTA8	2.9	32.3	256	0.044	0.078	YL8A_SCHPO Uncharacterized methyltransferase-like C25B8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25B8.10 PE=3 SV=1
18	P87230	3.6	32.3	305	0.037	0.056	COQ5_SCHPO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq5 PE=3 SV=1
19	P34666	5.1	31.6	285	0.044	0.070	COQ5_CAEEL 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-5 PE=3 SV=2
20	Q6FQY1	5.8	32.0	1005	0.112	0.051	STB5_CANGA Negative regulator of pleiotropic drug resistance STB5 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STB5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	3.2e-05	35.8	Methyltransferase domain
2	PF08242 Methyltransf_12	4.7	19.3	Methyltransferase domain
3	PF13649 Methyltransf_25	0.0022	29.9	Methyltransferase domain
4	PF13847 Methyltransf_31	12	17.1	Methyltransferase domain
5	PF05148 Methyltransf_8	3e-103	355.9	Hypothetical methyltransferase
6	PF01209 Ubie_methyltran	14	16.5	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254605

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.994	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000337976	0.984	Histone-lysine N-methyltransferase SUV39H1
3	9606.ENSP00000396673	0.968	pre-rRNA processing protein FTSJ3
4	9606.ENSP00000371858	0.961	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
5	9606.ENSP00000483495	0.956	Probable ATP-dependent RNA helicase DDX27
6	9606.ENSP00000417464	0.947	Ribosomal RNA processing protein 1 homolog A
7	9606.ENSP00000339145	0.946	Ribosomal RNA processing protein 1 homolog B
8	9606.ENSP00000354040	0.941	Nucleolar GTP-binding protein 1
9	9606.ENSP00000223073	0.938	RNA-binding protein 28
10	9606.ENSP00000232888	0.931	U3 small nucleolar RNA-interacting protein 2
11	9606.ENSP00000380982	0.921	Pumilio homolog 3
12	9606.ENSP00000285814	0.914	Nucleolar protein interacting with the FHA domain of MKI67
13	9606.ENSP00000402338	0.913	Ribosome production factor 2 homolog
14	9606.ENSP00000267425	0.912	Nucleolar protein 9
15	9606.ENSP00000407323	0.908	Probable rRNA-processing protein EBP2
16	9606.ENSP00000249396	0.906	NAD-dependent protein deacetylase sirtuin-2
17	9606.ENSP00000481495	0.901	ATP-dependent RNA helicase DDX24
18	9606.ENSP00000396976	0.900	Bromo adjacent homology domain-containing 1 protein
19	9606.ENSP00000323858	0.899	ATP-dependent RNA helicase DDX54
20	9606.ENSP00000203001	0.898	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0003723	1.000	RNA binding
GO:0035064	1.000	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.976	biological regulation
GO:0050789	0.971	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0071840	0.959	cellular component organization or biogenesis
GO:0031323	0.934	regulation of cellular metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0080090	0.929	regulation of primary metabolic process
GO:0010468	0.928	regulation of gene expression
GO:0048518	0.920	positive regulation of biological process
GO:0019219	0.918	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.893	positive regulation of cellular process
GO:0050896	0.876	response to stimulus
GO:0031326	0.818	regulation of cellular biosynthetic process
GO:0010556	0.812	regulation of macromolecule biosynthetic process
GO:0051252	0.799	regulation of RNA metabolic process
GO:0009893	0.774	positive regulation of metabolic process
GO:0044237	0.707	cellular metabolic process
GO:0071704	0.702	organic substance metabolic process
GO:0016043	0.678	cellular component organization
GO:0044238	0.675	primary metabolic process
GO:0051173	0.668	positive regulation of nitrogen compound metabolic process
GO:0031325	0.666	positive regulation of cellular metabolic process
GO:0006807	0.661	nitrogen compound metabolic process
GO:0010604	0.659	positive regulation of macromolecule metabolic process
GO:0048519	0.653	negative regulation of biological process
GO:0051716	0.643	cellular response to stimulus
GO:0043170	0.592	macromolecule metabolic process
GO:0051726	0.483	regulation of cell cycle
GO:0006950	0.480	response to stress
GO:0031324	0.472	negative regulation of cellular metabolic process
GO:0034641	0.471	cellular nitrogen compound metabolic process
GO:0010605	0.465	negative regulation of macromolecule metabolic process
GO:0051246	0.445	regulation of protein metabolic process
GO:0031399	0.439	regulation of protein modification process
GO:2001141	0.435	regulation of RNA biosynthetic process
GO:0045934	0.431	negative regulation of nucleobase-containing compound metabolic process
GO:0072332	0.424	intrinsic apoptotic signaling pathway by p53 class mediator
GO:0010558	0.423	negative regulation of macromolecule biosynthetic process
GO:0051247	0.422	positive regulation of protein metabolic process
GO:0006355	0.422	regulation of DNA-templated transcription
GO:0051253	0.422	negative regulation of RNA metabolic process
GO:0006996	0.418	organelle organization
GO:0031327	0.418	negative regulation of cellular biosynthetic process
GO:0033554	0.405	cellular response to stress
GO:0042149	0.403	cellular response to glucose starvation
GO:0032501	0.400	multicellular organismal process
GO:0006139	0.399	nucleobase-containing compound metabolic process
GO:0090304	0.394	nucleic acid metabolic process
GO:0006338	0.389	chromatin remodeling
GO:0045892	0.385	negative regulation of DNA-templated transcription
GO:0010629	0.380	negative regulation of gene expression
GO:0031507	0.374	heterochromatin formation
GO:0007000	0.371	nucleolus organization
GO:0010564	0.367	regulation of cell cycle process
GO:0031060	0.367	regulation of histone methylation
GO:0045786	0.352	negative regulation of cell cycle
GO:0042592	0.348	homeostatic process
GO:0140718	0.337	facultative heterochromatin formation
GO:0048871	0.335	multicellular organismal-level homeostasis
GO:0031063	0.333	regulation of histone deacetylation
GO:0097009	0.331	energy homeostasis
GO:0031062	0.331	positive regulation of histone methylation
GO:0010467	0.322	gene expression
GO:0016070	0.313	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0032991	0.998	protein-containing complex
GO:0005694	0.997	chromosome
GO:0005886	0.992	plasma membrane
GO:0140513	0.991	nuclear protein-containing complex
GO:0005677	0.984	chromatin silencing complex
GO:0000785	0.977	chromatin
GO:0000792	0.971	heterochromatin
GO:0033553	0.944	rDNA heterochromatin
GO:0061773	0.688	eNoSc complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]