StarFunc result for job id O43166

User Input

>input (1804 residues)
MTSLKRSQTERPLATDRASVVGTDGTPKVHTDDFYMRRFRSQNGSLGSSVMAPVGPPRSE
GSHHITSTPGVPKMGVRARIADWPPRKENIKESSRSSQEIETSSCLDSLSSKSSPVSQGS
SVSLNSNDSAMLKSIQNTLKNKTRPSENMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTP
TKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLSMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESASFESTLSSHCTNAGVAVLEVPKENLVLHLDRVKRY
IVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPDEMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVVPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRVHNPCSDSVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAEDYNKAMELDCLLGISNEFIVLIEQETKSVVFNCS
CRDVIGWTSTDTSLKIFYERGECVSVGSFINIEEIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEFKFPFRNNNKWQRNASKGPHSPQ
VPSQVQSPMTSRLNAGKGDGKMPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMA
LARSQCRNSPSNLSSSSDTGSVGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGSGKS
TPSWQRSEDSIADQMAYSYRGPQDFNSFVLEQHEYTEPTCHLPAVSKVLPAFRESPSGRL
MRQDPVVHLSPNKQGHSDSHYSSHSSSNTLSSNASSAHSDEKWYDGDRTESELNSYNYLQ
GTSADSGIDTTSYGPSHGSTASLGAATSSPRSGPGKEKVAPLWHSSSEVISMADRTLETE
SHGLDRKTESSLSLDIHSKSQAGSTPLTRENSTFSINDAASHTSTMSSRHSASPVVFTSA
RSSPKEELHPAAPSQLAPSFSSSSSSSSGPRSFYPRQGATSKYLIGWKKPEGTINSVGFM
DTRKRHQSDGNEIAHTRLRASTRDLRASPKPTSKSTIEEDLKKLIDLESPTPESQKSFKF
HALSSPQSPFPSTPTSRRALHRTLSDESIYNSQREHFFTSRASLLDQALPNDVLFSSTYP
SLPKSLPLRRPSYTLGMKSLHGEFSASDSSLTDIQETRRQPMPDPGLMPLPDTAADLDWS
NLVDAAKAYEVQRASFFAASDENHRPLSAASNSDQLEDQALAQMKPYSSSKDSSPTLASK
VDQLEGMLKMLREDLKKEKEDKAHLQAEVQHLREDNLRLQEESQNASDKLKKFTEWVFNT
IDMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RNK4	0.453	0.474	0.000	1718	0.435	0.456	A0A2R8RNK4.pdb.gz
2	AFDB:O35412	0.506	0.502	0.000	1822	0.942	0.932	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
3	AFDB:O43166	1.000	1.000	0.000	1804	1.000	1.000	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
4	AFDB:O60292	0.429	0.434	0.000	1781	0.479	0.486	O60292.pdb.gz	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
5	AFDB:Q8C0T5	0.528	0.534	0.000	1782	0.946	0.958	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
6	AFDB:Q9P2F8	0.498	0.519	0.000	1722	0.508	0.533	Q9P2F8.pdb.gz	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
7	PDB:7dl2B	0.109	0.174	1.558E-11	1042	0.041	0.071	7dl2B.pdb.gz
8	PDB:7dl2A	0.106	0.154	4.844E-11	1127	0.042	0.067	7dl2A.pdb.gz
9	AFDB:A1Z9K8	0.045	0.043	9.352E-6	1871	0.074	0.071	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
10	AFDB:Q17353	0.050	0.063	4.477E-5	1379	0.113	0.148	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
11	AFDB:A0A0B4JDC9	0.047	0.047	4.725E-5	1844	0.115	0.113	A0A0B4JDC9.pdb.gz	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
12	AFDB:Q86UR5	0.043	0.045	5.557E-5	1692	0.117	0.125	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
13	PDB:6r9tA	0.051	0.043	2.902E-4	2185	0.011	0.009	6r9tA.pdb.gz
14	PDB:7qqnC	0.044	0.173	5.856E-4	414	0.010	0.043	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:6t36A	0.040	0.731	8.546E-4	93	0.009	0.172	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7pcbA	0.043	0.175	1.005E-3	415	0.014	0.060	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7p73A	0.039	0.163	1.247E-3	420	0.012	0.050	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7pc3A	0.040	0.170	1.634E-3	405	0.012	0.052	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7p70A	0.040	0.170	1.820E-3	407	0.007	0.032	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7qqmA	0.039	0.165	1.921E-3	413	0.012	0.051	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PSX8	0.0	655	1040	0.190	0.330	E9PSX8_RAT Signal-induced proliferation-associated 1 OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=1 SV=1
2	F5GYF8	0.0	2592	1257	0.697	1.000	F5GYF8_HUMAN Signal induced proliferation associated 1 like 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=1
3	G3X9J0	0.0	1164	1776	0.341	0.347	SI1L3_MOUSE Signal-induced proliferation-associated 1-like protein 3 OS=Mus musculus OX=10090 GN=Sipa1l3 PE=1 SV=1
4	G5EBY5	0.0	585	995	0.164	0.297	G5EBY5_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sipa-1 PE=1 SV=1
5	O35412	0.0	3370	1822	0.943	0.934	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
6	O43166	0.0	3736	1804	1.000	1.000	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
7	O60292	0.0	1149	1781	0.342	0.346	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
8	P46062	0.0	638	1037	0.173	0.301	SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus OX=10090 GN=Sipa1 PE=1 SV=2
9	Q6I7S1	0.0	654	1040	0.190	0.329	Q6I7S1_RAT GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=2 SV=1
10	Q8C0T5	0.0	3418	1782	0.947	0.958	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
11	Q96FS4	0.0	665	1042	0.196	0.340	SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1
12	Q9P2F8	0.0	1322	1722	0.416	0.436	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
13	H2L055	3.03e-70	256	811	0.079	0.176	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
14	Q9VM02	5.78e-70	256	850	0.079	0.167	Q9VM02_DROME Rap GTPase activating protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
15	Q86RS9	1.21e-69	252	741	0.079	0.192	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
16	Q59DZ5	1.34e-69	255	876	0.079	0.162	Q59DZ5_DROME Rap GTPase activating protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
17	Q9VM00	1.60e-69	256	933	0.079	0.152	Q9VM00_DROME Rap GTPase activating protein 1, isoform D OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
18	O44090	1.71e-69	254	850	0.078	0.166	O44090_DROME GTPase activating protein for Rap1 OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=2 SV=1
19	A8DYW8	3.60e-69	255	959	0.079	0.148	A8DYW8_DROME Rap GTPase activating protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
20	Q5SVL6	7.17e-68	246	712	0.076	0.194	RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Rap1gap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	85	14.8	Autophagy protein 16 (ATG16)
2	PF09755 DUF2046	42	14.7	Uncharacterized conserved protein H4 (DUF2046)
3	PF13747 DUF4164	12	17.6	Domain of unknown function (DUF4164)
4	PF00595 PDZ	0.3	22.8	PDZ domain
5	PF17820 PDZ_6	20	16.5	PDZ domain
6	PF02145 Rap_GAP	3.4e-63	224.0	Rap/ran-GAP
7	PF15035 Rootletin	22	16.6	Ciliary rootlet component, centrosome cohesion
8	PF04136 Sec34	2.3e+02	13.1	Sec34-like family
9	PF11881 SPAR_C	2.5e-79	278.0	C-terminal domain of SPAR protein
10	PF06156 YabA	5.7e+02	12.6	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000450832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.926	Disks large homolog 4
2	9606.ENSP00000353496	0.921	Leucine zipper putative tumor suppressor 3
3	9606.ENSP00000358723	0.864	Ras-related protein Rap-1A
4	9606.ENSP00000250559	0.852	Ras-related protein Rap-1b
5	9606.ENSP00000370981	0.788	Leucine zipper putative tumor suppressor 1
6	9606.ENSP00000304192	0.705	Pecanex-like protein 1
7	9606.ENSP00000365272	0.680	Disks large homolog 2
8	9606.ENSP00000267594	0.677	Protein FAM181A
9	9606.ENSP00000319739	0.667	Reticulocalbin-2
10	9606.ENSP00000359240	0.663	Leucine zipper putative tumor suppressor 2
11	9606.ENSP00000363480	0.661	Disks large homolog 3
12	9606.ENSP00000336127	0.653	Tetratricopeptide repeat protein 7B
13	9606.ENSP00000378400	0.653	LIM domain and actin-binding protein 1
14	9606.ENSP00000480359	0.652	PDZ and LIM domain protein 5
15	9606.ENSP00000417518	0.647	CLIP-associating protein 2
16	9606.ENSP00000368856	0.632	Transcriptional repressor NF-X1
17	9606.ENSP00000379818	0.632	Glutamate receptor ionotropic, NMDA 2A
18	9606.ENSP00000477455	0.624	Glutamate receptor ionotropic, NMDA 2B
19	9606.ENSP00000376848	0.619	Proline-rich membrane anchor 1
20	9606.ENSP00000262726	0.614	EF-hand calcium-binding domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.633	molecular function regulator activity
GO:0030234	0.447	enzyme regulator activity
GO:0140677	0.370	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.923	response to stimulus
GO:0043087	0.908	regulation of GTPase activity
GO:0051716	0.905	cellular response to stimulus
GO:0051128	0.861	regulation of cellular component organization
GO:0031344	0.823	regulation of cell projection organization
GO:0023052	0.805	signaling
GO:0007154	0.805	cell communication
GO:0010975	0.785	regulation of neuron projection development
GO:0007165	0.783	signal transduction
GO:0007166	0.636	cell surface receptor signaling pathway
GO:0022603	0.584	regulation of anatomical structure morphogenesis
GO:0007167	0.409	enzyme-linked receptor protein signaling pathway
GO:0071840	0.308	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005856	0.996	cytoskeleton
GO:0005737	0.963	cytoplasm
GO:0015629	0.959	actin cytoskeleton
GO:0005829	0.858	cytosol
GO:0043231	0.799	intracellular membrane-bounded organelle
GO:0032991	0.425	protein-containing complex
GO:0005634	0.389	nucleus
GO:0030054	0.324	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]