StarFunc result for job id O43169

User Input

>input (150 residues)
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCK
SCWAYWILPIIGAVLLGFLYRYYTSESKSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43169	1.000	1.000	1.066E-28	150	1.000	1.000	O43169.pdb.gz	CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3
2	AFDB:P04166	0.589	0.605	1.572E-23	146	0.727	0.747	P04166.pdb.gz	CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus OX=10116 GN=Cyb5b PE=1 SV=2
3	AFDB:Q6NY41	0.602	0.590	4.073E-19	153	0.513	0.503	Q6NY41.pdb.gz	Q6NY41_DANRE Cytochrome b5 type B OS=Danio rerio OX=7955 GN=zgc:76963 PE=2 SV=1
4	AFDB:P00173	0.559	0.623	1.279E-16	134	0.413	0.463	P00173.pdb.gz	CYB5_RAT Cytochrome b5 OS=Rattus norvegicus OX=10116 GN=Cyb5a PE=1 SV=2
5	AFDB:A8WGS0	0.555	0.607	2.497E-16	137	0.453	0.496	A8WGS0.pdb.gz	A8WGS0_DANRE Cyb5a protein OS=Danio rerio OX=7955 GN=cyb5 PE=1 SV=1
6	AFDB:A0A384ME44	0.555	0.620	2.854E-16	134	0.440	0.493	A0A384ME44.pdb.gz	A0A384ME44_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:Q9V4N3	0.572	0.639	1.926E-14	134	0.367	0.410	Q9V4N3.pdb.gz	CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster OX=7227 GN=Cyt-b5 PE=2 SV=1
8	AFDB:O48845	0.529	0.589	2.691E-14	134	0.327	0.366	O48845.pdb.gz	CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana OX=3702 GN=CYTB5-B PE=1 SV=1
9	AFDB:Q9FDW8	0.548	0.608	4.019E-14	135	0.340	0.378	Q9FDW8.pdb.gz	CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana OX=3702 GN=CB5-A PE=1 SV=1
10	AFDB:Q9ZWT2	0.543	0.581	6.862E-14	140	0.333	0.357	Q9ZWT2.pdb.gz	CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana OX=3702 GN=CYTB5-D PE=1 SV=1
11	PDB:1t0gA	0.363	0.473	2.109E-3	109	0.147	0.202	1t0gA.pdb.gz
12	PDB:7cgpC	0.122	0.089	1.689	223	0.093	0.063	7cgpC.pdb.gz
13	PDB:7oyaL1	0.122	0.107	1.931	197	0.107	0.081	7oyaL1.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
14	PDB:7pzyt	0.138	0.109	4.307	200	0.053	0.040	7pzyt.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:4zdjA	0.097	0.035	4.923	535	0.093	0.026	4zdjA.pdb.gz	Thiophenecarboxamide Derivatives Activated by EthA Kill Mycobacterium tuberculosis by Inhibiting the CTP Synthetase PyrG.
16	PDB:7on9A	0.097	0.042	4.923	393	0.087	0.033	7on9A.pdb.gz	Debottlenecking 4-hydroxybenzoate hydroxylation in Pseudomonas putida KT2440 improves muconate productivity from p-coumarate.
17	PDB:1gz0F	0.118	0.083	6.432	253	0.107	0.063	1gz0F.pdb.gz
18	PDB:3j9qA	0.084	0.046	6.432	385	0.060	0.023	3j9qA.pdb.gz
19	PDB:1d7lA	0.079	0.036	6.877	394	0.060	0.023	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
20	PDB:6qmuA	0.118	0.102	6.877	184	0.020	0.016	6qmuA.pdb.gz	A Tetrahedral Boronic Acid Diester Formed by an Unnatural Amino Acid in the Ligand Pocket of an Engineered Lipocalin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43169	9.83e-110	310	150	1.000	1.000	CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3
2	P04166	3.98e-83	242	146	0.727	0.747	CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus OX=10116 GN=Cyb5b PE=1 SV=2
3	Q9CQX2	1.24e-81	238	146	0.733	0.753	CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus OX=10090 GN=Cyb5b PE=1 SV=1
4	Q6NY41	6.32e-51	161	153	0.513	0.503	Q6NY41_DANRE Cytochrome b5 type B OS=Danio rerio OX=7955 GN=zgc:76963 PE=2 SV=1
5	A8WGS0	1.06e-46	150	137	0.493	0.540	A8WGS0_DANRE Cyb5a protein OS=Danio rerio OX=7955 GN=cyb5 PE=1 SV=1
6	Q7T341	5.04e-46	148	137	0.487	0.533	Q7T341_DANRE Cytochrome b5 OS=Danio rerio OX=7955 GN=wu:fb44a11 PE=1 SV=1
7	A0A384ME44	4.29e-43	140	134	0.447	0.500	A0A384ME44_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	P00167	4.29e-43	140	134	0.447	0.500	CYB5_HUMAN Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A PE=1 SV=2
9	P00173	1.30e-40	134	134	0.420	0.470	CYB5_RAT Cytochrome b5 OS=Rattus norvegicus OX=10116 GN=Cyb5a PE=1 SV=2
10	P56395	4.40e-40	133	134	0.407	0.455	CYB5_MOUSE Cytochrome b5 OS=Mus musculus OX=10090 GN=Cyb5a PE=1 SV=2
11	Q9V4N3	1.47e-36	124	134	0.387	0.433	CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster OX=7227 GN=Cyt-b5 PE=2 SV=1
12	M9NEX3	1.85e-29	105	106	0.313	0.443	M9NEX3_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=BcDNA:RH45308 PE=1 SV=1
13	Q9ZWT2	2.32e-29	106	140	0.373	0.400	CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana OX=3702 GN=CYTB5-D PE=1 SV=1
14	Q8SY77	3.20e-29	104	89	0.313	0.528	Q8SY77_DROME GEO11431p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3566 PE=1 SV=1
15	Q8IRR0	5.37e-29	104	117	0.313	0.402	Q8IRR0_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3566 PE=1 SV=3
16	Q93315	6.55e-28	102	134	0.333	0.373	Q93315_CAEEL Cytochrome b5 heme-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cytb-5.1 PE=1 SV=2
17	Q42342	1.01e-27	102	134	0.340	0.381	CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana OX=3702 GN=CYTB5-E PE=1 SV=2
18	O48845	3.26e-27	100	134	0.293	0.328	CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana OX=3702 GN=CYTB5-B PE=1 SV=1
19	Q9FDW8	3.35e-26	98.2	135	0.320	0.356	CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana OX=3702 GN=CB5-A PE=1 SV=1
20	A0A1D8PQP7	8.71e-26	96.7	126	0.320	0.381	A0A1D8PQP7_CANAL Cyb5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYB5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00173 Cyt-b5	2.7e-21	86.8	Cytochrome b5-like Heme/Steroid binding domain
2	PF10003 DUF2244	6.5e+02	11.4	Integral membrane protein (DUF2244)
3	PF00230 MIP	3.9e+02	12.1	Major intrinsic protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354468	0.936	NADH-cytochrome b5 reductase 3
2	9606.ENSP00000355880	0.870	Mitochondrial amidoxime reducing component 2
3	9606.ENSP00000355877	0.831	Mitochondrial amidoxime-reducing component 1
4	9606.ENSP00000330918	0.704	Glycerol-3-phosphate phosphatase
5	9606.ENSP00000356218	0.651	NADH-cytochrome b5 reductase 1
6	9606.ENSP00000377357	0.645	Palmitoyltransferase ZDHHC16
7	9606.ENSP00000378416	0.617	5-aminolevulinate synthase, nonspecific, mitochondrial
8	9606.ENSP00000332407	0.613	Short chain dehydrogenase/reductase family 42E, member 1
9	9606.ENSP00000441980	0.612	Choline/ethanolaminephosphotransferase 1
10	9606.ENSP00000420161	0.610	Beta-1,4-galactosyltransferase 4
11	9606.ENSP00000350757	0.609	Glia maturation factor beta
12	9606.ENSP00000302478	0.605	DNA-directed RNA polymerases I and III subunit RPAC2
13	9606.ENSP00000419970	0.595	NADPH--cytochrome P450 reductase
14	9606.ENSP00000225792	0.582	Probable ATP-dependent RNA helicase DDX5
15	9606.ENSP00000380033	0.582	Probable ATP-dependent RNA helicase DDX17
16	9606.ENSP00000246337	0.576	Uroporphyrinogen decarboxylase
17	9606.ENSP00000220853	0.575	ER membrane protein complex subunit 2
18	9606.ENSP00000354554	0.550	Cytochrome b
19	9606.ENSP00000437041	0.547	NADH-cytochrome b5 reductase 2
20	9606.ENSP00000003100	0.543	Lanosterol 14-alpha demethylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016491	1.000	oxidoreductase activity
GO:0020037	0.999	heme binding
GO:0005515	0.984	protein binding
GO:0016661	0.879	oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0016662	0.862	oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor
GO:0098809	0.860	nitrite reductase activity
GO:0022857	0.454	transmembrane transporter activity
GO:0015318	0.339	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0044249	0.981	cellular biosynthetic process
GO:0006807	0.913	nitrogen compound metabolic process
GO:0034641	0.790	cellular nitrogen compound metabolic process
GO:0071704	0.783	organic substance metabolic process
GO:0006809	0.729	nitric oxide biosynthetic process
GO:0044238	0.492	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	1.000	organelle membrane
GO:0005739	1.000	mitochondrion
GO:0031975	0.999	envelope
GO:0031967	0.993	organelle envelope
GO:0032991	0.980	protein-containing complex
GO:0005740	0.965	mitochondrial envelope
GO:0031966	0.962	mitochondrial membrane
GO:1902494	0.673	catalytic complex
GO:0098588	0.629	bounding membrane of organelle
GO:0019867	0.618	outer membrane
GO:0031968	0.603	organelle outer membrane
GO:0005741	0.379	mitochondrial outer membrane
GO:0012505	0.340	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.
EC:1.7.-.-	0.879	Acting on other nitrogenous compounds as donors.
EC:1.7.2.-	0.862	With a cytochrome as acceptor.

[back to server]