StarFunc result for job id O43173

User Input

>input (380 residues)
MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFR
SQFALKFLDPSFVPITNSLTQELQEKPSKWKFNRTAFLHQRQEILQHVDVIKNFSLTKNS
VRIGQLMHYDYSSHKYVFSISNNFRSLLPDVSPIMNKHYNICAVVGNSGILTGSQCGQEI
DKSDFVFRCNFAPTEAFQRDVGRKTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDG
AILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYWKNKHLSPKRLS
TGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEF
QLLYRMHGEGLTKLTLSHCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43173	1.000	1.000	1.193E-79	380	1.000	1.000	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
2	AFDB:B0CN48	0.830	0.843	3.142E-66	374	0.787	0.799	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
3	AFDB:Q6KC03	0.750	0.795	6.400E-38	358	0.318	0.338	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
4	AFDB:Q1LVN2	0.764	0.762	1.113E-37	381	0.326	0.325	Q1LVN2.pdb.gz
5	AFDB:O35696	0.767	0.777	4.861E-37	375	0.332	0.336	O35696.pdb.gz	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
6	AFDB:A1KQY6	0.736	0.619	1.426E-35	454	0.324	0.271	A1KQY6.pdb.gz	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
7	AFDB:Q6ZXA0	0.723	0.763	1.189E-33	359	0.276	0.292	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
8	AFDB:G3V7T2	0.718	0.763	1.617E-33	356	0.263	0.281	G3V7T2.pdb.gz	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
9	AFDB:Q8K4T1	0.718	0.687	6.065E-32	398	0.274	0.261	Q8K4T1.pdb.gz	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
10	AFDB:F1R0F8	0.733	0.774	1.524E-31	359	0.284	0.301	F1R0F8.pdb.gz
11	PDB:6aplC	0.462	0.559	3.019E-12	306	0.168	0.209	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:2c95A	0.109	0.163	1.012E-2	195	0.074	0.144	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
13	PDB:1b3oA	0.170	0.197	4.701E-2	304	0.095	0.118	1b3oA.pdb.gz	Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
14	PDB:1qf9A	0.120	0.187	5.316E-2	194	0.050	0.098	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
15	PDB:3tlxB	0.150	0.207	5.316E-2	240	0.068	0.108	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
16	PDB:2axqA	0.138	0.122	6.392E-2	445	0.053	0.045	2axqA.pdb.gz
17	PDB:7mqaSI	0.170	0.095	7.686E-2	803	0.061	0.029	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:4pvdC	0.184	0.214	8.690E-2	308	0.097	0.120	4pvdC.pdb.gz	Structural insights into the cofactor-assisted substrate recognition of yeast methylglyoxal/isovaleraldehyde reductase Gre2
19	PDB:7ln6F	0.133	0.083	9.241E-2	714	0.053	0.028	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
20	PDB:3geiA	0.121	0.111	9.827E-2	428	0.071	0.063	3geiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0CN48	0.0	649	374	0.789	0.802	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
2	O43173	0.0	797	380	1.000	1.000	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
3	Q64689	0.0	781	380	0.979	0.979	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
4	Q92186	5.73e-76	241	375	0.318	0.323	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
5	Q07977	7.83e-75	238	375	0.313	0.317	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1
6	O35696	8.53e-75	238	375	0.345	0.349	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
7	Q6KC03	1.02e-70	227	358	0.305	0.324	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
8	Q8QH83	2.14e-70	227	381	0.305	0.304	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
9	Q92187	9.22e-70	225	359	0.308	0.326	SIA8D_HUMAN CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA4 PE=1 SV=1
10	Q64692	3.35e-69	223	359	0.308	0.326	SIA8D_MOUSE CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia4 PE=2 SV=1
11	Q64690	1.07e-68	222	359	0.305	0.323	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
12	A1KQY6	4.98e-68	223	454	0.303	0.253	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
13	P61647	2.90e-54	186	398	0.284	0.271	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
14	Q8K4T1	9.37e-54	184	398	0.276	0.264	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
15	Q6ZXA0	3.79e-50	174	359	0.292	0.309	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
16	Q92185	1.96e-48	169	356	0.261	0.278	SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA1 PE=1 SV=1
17	Q64687	6.45e-48	168	355	0.266	0.285	SIA8A_MOUSE Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia1 PE=1 SV=2
18	G3V7T2	5.15e-47	166	356	0.258	0.275	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
19	Q6ZXC8	2.28e-38	143	376	0.224	0.226	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
20	P70126	6.65e-38	142	412	0.224	0.206	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	3.8e-66	235.0	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369055	0.926	Beta-1,4-galactosyltransferase 1
2	9606.ENSP00000420161	0.903	Beta-1,4-galactosyltransferase 4
3	9606.ENSP00000480428	0.903	Beta-1,4-galactosyltransferase 3
4	9606.ENSP00000480132	0.816	Neural cell adhesion molecule 1
5	9606.ENSP00000258742	0.706	Nucleoporin-like protein 2
6	9606.ENSP00000379704	0.638	Neuronal-specific septin-3
7	9606.ENSP00000366617	0.610	COBW domain containing 1
8	9606.ENSP00000353295	0.588	COBW domain containing 3
9	9606.ENSP00000297273	0.584	N-acetylneuraminate 9-O-acetyltransferase
10	9606.ENSP00000256509	0.559	Neural cell adhesion molecule L1-like protein
11	9606.ENSP00000286808	0.553	Claudin-17
12	9606.ENSP00000440374	0.543	Guanine nucleotide exchange factor DBS
13	9606.ENSP00000255224	0.508	Synaptotagmin-4
14	9606.ENSP00000391227	0.503	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
15	9606.ENSP00000370981	0.500	Leucine zipper putative tumor suppressor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	0.999	sialyltransferase activity
GO:0005488	0.979	binding
GO:0005515	0.970	protein binding
GO:0003828	0.704	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity
GO:0033691	0.331	sialic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.960	cellular process
GO:0071704	0.943	organic substance metabolic process
GO:0044238	0.930	primary metabolic process
GO:0006807	0.807	nitrogen compound metabolic process
GO:0044237	0.797	cellular metabolic process
GO:1901564	0.777	organonitrogen compound metabolic process
GO:1901135	0.646	carbohydrate derivative metabolic process
GO:1901576	0.495	organic substance biosynthetic process
GO:1901137	0.476	carbohydrate derivative biosynthetic process
GO:0044249	0.465	cellular biosynthetic process
GO:1901566	0.453	organonitrogen compound biosynthetic process
GO:0032502	0.408	developmental process
GO:0048856	0.386	anatomical structure development
GO:0043170	0.348	macromolecule metabolic process
GO:0065007	0.327	biological regulation
GO:0050789	0.322	regulation of biological process
GO:0019538	0.309	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	0.999	Glycosyltransferases.
RHEA:19313	0.704	an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+)
EC:2.4.99.8	0.704	Transferred entry: 2.4.3.8.

[back to server]