StarFunc result for job id O43174

User Input

>input (497 residues)
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V861	0.986	0.986	1.419E-72	497	0.922	0.922	G3V861.pdb.gz	G3V861_RAT Cytochrome P450, family 26, subfamily a, polypeptide 1 OS=Rattus norvegicus OX=10116 GN=Cyp26a1 PE=3 SV=1
2	AFDB:Q9PUB4	0.957	0.966	3.130E-64	492	0.793	0.801	Q9PUB4.pdb.gz	CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus OX=9031 GN=CYP26A1 PE=1 SV=1
3	AFDB:P79739	0.961	0.970	5.561E-59	492	0.678	0.685	P79739.pdb.gz	CP26A_DANRE Cytochrome P450 26A1 OS=Danio rerio OX=7955 GN=cyp26a1 PE=1 SV=1
4	AFDB:Q6EIG3	0.906	0.882	1.199E-45	511	0.433	0.421	Q6EIG3.pdb.gz	CP26B_DANRE Cytochrome P450 26B1 OS=Danio rerio OX=7955 GN=cyp26b1 PE=1 SV=1
5	AFDB:B2RXA7	0.917	0.881	9.059E-45	518	0.435	0.417	B2RXA7.pdb.gz	CP26C_MOUSE Cytochrome P450 26C1 OS=Mus musculus OX=10090 GN=Cyp26c1 PE=1 SV=1
6	AFDB:G3V7X8	0.927	0.901	9.485E-45	512	0.443	0.430	G3V7X8.pdb.gz	CP26B_RAT Cytochrome P450 26B1 OS=Rattus norvegicus OX=10116 GN=Cyp26b1 PE=2 SV=1
7	AFDB:A1L1M2	0.919	0.827	9.018E-44	554	0.447	0.401	A1L1M2.pdb.gz	A1L1M2_DANRE Cytochrome P450, family 26, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp26b1l PE=1 SV=1
8	AFDB:Q6V0L0	0.925	0.882	1.970E-43	522	0.463	0.441	Q6V0L0.pdb.gz	CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens OX=9606 GN=CYP26C1 PE=1 SV=2
9	AFDB:K4CEE8	0.841	0.866	1.233E-31	482	0.298	0.307	K4CEE8.pdb.gz	C7A46_SOLLC Beta-amyrin 28-monooxygenase OS=Solanum lycopersicum OX=4081 GN=CYP716A46 PE=1 SV=1
10	AFDB:Q84KI1	0.839	0.820	1.701E-31	509	0.270	0.263	Q84KI1.pdb.gz	T14H_TAXCU Taxoid 14-beta-hydroxylase OS=Taxus cuspidata OX=99806 PE=1 SV=1
11	PDB:6a16A	0.776	0.873	1.002E-23	439	0.241	0.273	6a16A.pdb.gz	Structural insights into a key step of brassinosteroid biosynthesis and its inhibition.
12	PDB:5jlcA	0.768	0.756	6.874E-22	506	0.223	0.219	5jlcA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
13	PDB:5eqbA	0.792	0.745	9.929E-22	531	0.241	0.226	5eqbA.pdb.gz	Architecture of a single membrane spanning cytochrome P450 suggests constraints that orient the catalytic domain relative to a bilayer.
14	PDB:7n3mAAA	0.750	0.847	1.978E-21	437	0.211	0.240	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
15	PDB:5v5zA	0.763	0.776	3.280E-21	488	0.233	0.238	5v5zA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
16	PDB:7mk8B	0.758	0.806	1.495E-20	465	0.207	0.222	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
17	PDB:5veuC	0.773	0.816	2.062E-20	469	0.193	0.205	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
18	PDB:3k9vA	0.779	0.830	2.845E-20	464	0.187	0.200	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
19	PDB:7cb9A	0.804	0.854	3.924E-20	466	0.197	0.210	7cb9A.pdb.gz	CYP76AH1 from Salvia miltiorrhiza
20	PDB:6b82B	0.743	0.782	6.214E-20	470	0.191	0.202	6b82B.pdb.gz	Inherent steroid 17 alpha ,20-lyase activity in defunct cytochrome P450 17A enzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V861	0.0	921	497	0.922	0.922	G3V861_RAT Cytochrome P450, family 26, subfamily a, polypeptide 1 OS=Rattus norvegicus OX=10116 GN=Cyp26a1 PE=3 SV=1
2	O43174	0.0	1026	497	1.000	1.000	CP26A_HUMAN Cytochrome P450 26A1 OS=Homo sapiens OX=9606 GN=CYP26A1 PE=1 SV=2
3	O55127	0.0	938	497	0.938	0.938	CP26A_MOUSE Cytochrome P450 26A1 OS=Mus musculus OX=10090 GN=Cyp26a1 PE=1 SV=1
4	P79739	0.0	695	492	0.682	0.689	CP26A_DANRE Cytochrome P450 26A1 OS=Danio rerio OX=7955 GN=cyp26a1 PE=1 SV=1
5	Q2PMW7	0.0	919	497	0.920	0.920	Q2PMW7_RAT Retinoic acid hydroxylase OS=Rattus norvegicus OX=10116 GN=Cyp26a1 PE=2 SV=1
6	Q304P5	0.0	913	497	0.913	0.913	Q304P5_RAT Retinoic acid hydroxylase OS=Rattus norvegicus OX=10116 GN=Cyp26a1 PE=2 SV=1
7	Q8VIL0	0.0	919	497	0.920	0.920	Q8VIL0_RAT Retinoic acid hydroxylase OS=Rattus norvegicus OX=10116 GN=Cyp26a1 PE=2 SV=2
8	Q9PUB4	0.0	787	492	0.795	0.803	CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus OX=9031 GN=CYP26A1 PE=1 SV=1
9	G3V7X8	2.90e-135	402	512	0.451	0.438	CP26B_RAT Cytochrome P450 26B1 OS=Rattus norvegicus OX=10116 GN=Cyp26b1 PE=2 SV=1
10	Q811W2	1.68e-134	400	512	0.445	0.432	CP26B_MOUSE Cytochrome P450 26B1 OS=Mus musculus OX=10090 GN=Cyp26b1 PE=1 SV=1
11	Q6V0L0	3.83e-134	400	522	0.445	0.423	CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens OX=9606 GN=CYP26C1 PE=1 SV=2
12	A1L1M2	6.11e-134	400	554	0.463	0.415	A1L1M2_DANRE Cytochrome P450, family 26, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp26b1l PE=1 SV=1
13	Q9NR63	1.97e-132	395	512	0.437	0.424	CP26B_HUMAN Cytochrome P450 26B1 OS=Homo sapiens OX=9606 GN=CYP26B1 PE=1 SV=1
14	B2RXA7	9.81e-130	388	518	0.421	0.403	CP26C_MOUSE Cytochrome P450 26C1 OS=Mus musculus OX=10090 GN=Cyp26c1 PE=1 SV=1
15	Q6EIG3	1.48e-129	387	511	0.447	0.434	CP26B_DANRE Cytochrome P450 26B1 OS=Danio rerio OX=7955 GN=cyp26b1 PE=1 SV=1
16	Q2MJ20	2.32e-69	231	479	0.320	0.332	C7A12_MEDTR Beta-amyrin 28-monooxygenase OS=Medicago truncatula OX=3880 GN=CYP716A12 PE=1 SV=1
17	A0A140JWM8	1.08e-67	226	473	0.302	0.317	C7162_ARATH Cytochrome P450 716A2 OS=Arabidopsis thaliana OX=3702 GN=CYP716A2 PE=2 SV=1
18	K4CEE8	1.40e-64	219	482	0.290	0.299	C7A46_SOLLC Beta-amyrin 28-monooxygenase OS=Solanum lycopersicum OX=4081 GN=CYP716A46 PE=1 SV=1
19	F6H9N6	1.14e-62	213	480	0.284	0.294	C7A15_VITVI Beta-amyrin 28-monooxygenase OS=Vitis vinifera OX=29760 GN=CYP716A15 PE=1 SV=1
20	A0A3Q7HBJ5	1.32e-62	213	476	0.292	0.305	C7A44_SOLLC Beta-amyrin 28-monooxygenase OS=Solanum lycopersicum OX=4081 GN=CYP716A44 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	1.8e-60	216.7	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000224356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249750	0.992	Retinal dehydrogenase 2
2	9606.ENSP00000240285	0.975	Retinol dehydrogenase 10
3	9606.ENSP00000299529	0.974	Cellular retinoic acid-binding protein 1
4	9606.ENSP00000332256	0.973	Aldehyde dehydrogenase family 1 member A3
5	9606.ENSP00000480439	0.968	Short-chain dehydrogenase/reductase 3
6	9606.ENSP00000297785	0.967	Retinal dehydrogenase 1
7	9606.ENSP00000337224	0.959	Lecithin retinol acyltransferase
8	9606.ENSP00000231572	0.958	Arginine--tRNA ligase, cytoplasmic
9	9606.ENSP00000381206	0.952	Retinol dehydrogenase 16
10	9606.ENSP00000389241	0.947	Dehydrogenase/reductase SDR family member 9
11	9606.ENSP00000370750	0.944	Retinol dehydrogenase 11
12	9606.ENSP00000337915	0.940	Cytochrome P450 3A4
13	9606.ENSP00000420269	0.939	Alcohol dehydrogenase class 4 mu/sigma chain
14	9606.ENSP00000369050	0.938	Cytochrome P450 1A1
15	9606.ENSP00000480571	0.937	Cytochrome P450 3A7
16	9606.ENSP00000265512	0.936	Alcohol dehydrogenase 4, pi polypeptide
17	9606.ENSP00000449079	0.936	Retinol dehydrogenase 12
18	9606.ENSP00000209668	0.935	Alcohol dehydrogenase 1A, alpha polypeptide
19	9606.ENSP00000222982	0.935	Cytochrome P450 3A5
20	9606.ENSP00000308032	0.935	Cytochrome P450 2S1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.798	binding
GO:0005515	0.371	protein binding
GO:0016709	0.319	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0050896	0.972	response to stimulus
GO:0042221	0.960	response to chemical
GO:0032501	0.944	multicellular organismal process
GO:0032502	0.938	developmental process
GO:0006629	0.927	lipid metabolic process
GO:0048856	0.925	anatomical structure development
GO:0065007	0.893	biological regulation
GO:0044281	0.827	small molecule metabolic process
GO:0044255	0.827	cellular lipid metabolic process
GO:0007275	0.822	multicellular organism development
GO:0048731	0.751	system development
GO:0032526	0.710	response to retinoic acid
GO:0001822	0.692	kidney development
GO:0033189	0.684	response to vitamin A
GO:0006720	0.656	isoprenoid metabolic process
GO:0006721	0.514	terpenoid metabolic process
GO:0016101	0.494	diterpenoid metabolic process
GO:0042445	0.486	hormone metabolic process
GO:0032787	0.477	monocarboxylic acid metabolic process
GO:0001523	0.441	retinoid metabolic process
GO:0016042	0.407	lipid catabolic process
GO:0051716	0.388	cellular response to stimulus
GO:0050789	0.368	regulation of biological process
GO:0050794	0.338	regulation of cellular process
GO:0008300	0.330	isoprenoid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.13.-	0.319	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]