StarFunc result for job id O43181

User Input

>input (175 residues)
MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLD
ITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP
LSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z433	0.753	0.753	5.493E-32	175	1.000	1.000	A0A0S2Z433.pdb.gz	A0A0S2Z433_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=NDUFS4 PE=2 SV=1
2	AFDB:Q9CXZ1	0.775	0.775	3.009E-31	175	0.874	0.874	Q9CXZ1.pdb.gz	NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs4 PE=1 SV=3
3	PDB:7qskQ	0.720	0.973	6.824E-24	129	0.703	0.953	7qskQ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
4	AFDB:Q9N4L8	0.640	0.636	5.058E-16	176	0.451	0.449	Q9N4L8.pdb.gz	Q9N4L8_CAEEL NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lpd-5 PE=1 SV=2
5	AFDB:Q9FJW4	0.582	0.654	3.075E-13	154	0.331	0.377	Q9FJW4.pdb.gz	NDUS4_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FRO1 PE=1 SV=1
6	AFDB:A0A1D8PCD3	0.628	0.701	2.493E-12	156	0.303	0.340	A0A1D8PCD3.pdb.gz	A0A1D8PCD3_CANAL NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C101010WA PE=3 SV=1
7	PDB:7aqrQ	0.587	0.849	9.192E-12	119	0.291	0.429	7aqrQ.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
8	PDB:7wi3E	0.158	0.275	4.127E-1	81	0.069	0.148	7wi3E.pdb.gz
9	PDB:7pzyAL	0.230	0.405	7.938E-1	77	0.063	0.143	7pzyAL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
10	PDB:6w1sI	0.115	0.029	8.475E-1	1077	0.057	0.009	6w1sI.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
11	PDB:7mscq	0.099	0.143	9.048E-1	95	0.074	0.137	7mscq.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
12	AFDB:B2ZFP3	0.189	0.051	1.344	807	0.074	0.016	B2ZFP3.pdb.gz	SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio OX=7955 GN=smarcal1 PE=2 SV=1
13	PDB:1qsmD	0.078	0.087	2.118	152	0.074	0.086	1qsmD.pdb.gz	Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
14	PDB:7myjC	0.067	0.042	2.118	465	0.063	0.024	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	AFDB:B3DKQ1	0.118	0.033	2.268	905	0.069	0.013	B3DKQ1.pdb.gz
16	PDB:6z99B	0.100	0.034	2.751	658	0.046	0.012	6z99B.pdb.gz	Acquisition of ionic copper by the bacterial outer membrane protein OprC through a novel binding site.
17	PDB:6dbiC	0.123	0.049	2.937	622	0.097	0.027	6dbiC.pdb.gz	DNA melting initiates the RAG catalytic pathway.
18	AFDB:Q9LW15	0.150	0.149	3.359	176	0.074	0.074	Q9LW15.pdb.gz	CX5B1_ARATH Cytochrome c oxidase subunit 5b-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-1 PE=1 SV=1
19	AFDB:Q6ZY51	0.135	0.038	3.586	1196	0.126	0.018	Q6ZY51.pdb.gz	PWD_ARATH Phosphoglucan, water dikinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GWD3 PE=1 SV=1
20	AFDB:P50572	0.113	0.055	4.087	480	0.126	0.046	P50572.pdb.gz	GBRR1_RAT Gamma-aminobutyric acid receptor subunit rho-1 OS=Rattus norvegicus OX=10116 GN=Gabrr1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z433	2.74e-127	356	175	1.000	1.000	A0A0S2Z433_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=NDUFS4 PE=2 SV=1
2	O43181	2.74e-127	356	175	1.000	1.000	NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1
3	Q02375	8.83e-117	330	175	0.909	0.909	NDUS4_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS4 PE=1 SV=1
4	Q9CXZ1	3.09e-104	298	175	0.874	0.874	NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs4 PE=1 SV=3
5	Q9N4L8	6.94e-45	147	176	0.451	0.449	Q9N4L8_CAEEL NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lpd-5 PE=1 SV=2
6	Q9FJW4	2.43e-30	110	154	0.314	0.357	NDUS4_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FRO1 PE=1 SV=1
7	A0A1D8PCD3	2.74e-22	89.4	156	0.286	0.321	A0A1D8PCD3_CANAL NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C101010WA PE=3 SV=1
8	Q9NRA1	0.17	34.3	345	0.103	0.052	PDGFC_HUMAN Platelet-derived growth factor C OS=Homo sapiens OX=9606 GN=PDGFC PE=1 SV=2
9	Q8CI19	1.1	32.0	345	0.097	0.049	PDGFC_MOUSE Platelet-derived growth factor C OS=Mus musculus OX=10090 GN=Pdgfc PE=1 SV=2
10	Q8MY02	3.4	30.4	636	0.080	0.022	Q8MY02_DROME FI14518p OS=Drosophila melanogaster OX=7227 GN=pxb PE=2 SV=1
11	K9IMD0	8.8	29.3	708	0.166	0.041	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10075 CSN8_PSD8_EIF3K	2.1e+02	13.4	CSN8/PSMD8/EIF3K family
2	PF07987 DUF1775	1.2e+02	14.4	Domain of unkown function (DUF1775)
3	PF04800 NDUS4	6.1e-35	130.7	NADH dehydrogenase ubiquinone Fe-S protein 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296684

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000237889	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
5	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
6	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
7	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
8	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
9	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
10	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
11	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
12	9606.ENSP00000276062	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
13	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
14	9606.ENSP00000281031	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
15	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
16	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
17	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
18	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
19	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
20	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity
GO:0005488	0.995	binding
GO:0005515	0.952	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006091	0.992	generation of precursor metabolites and energy
GO:0010257	0.987	NADH dehydrogenase complex assembly
GO:0007005	0.976	mitochondrion organization
GO:0015980	0.975	energy derivation by oxidation of organic compounds
GO:0033108	0.967	mitochondrial respiratory chain complex assembly
GO:0045333	0.964	cellular respiration
GO:0032981	0.963	mitochondrial respiratory chain complex I assembly
GO:0050896	0.512	response to stimulus
GO:0065007	0.451	biological regulation
GO:0009060	0.447	aerobic respiration
GO:0050789	0.428	regulation of biological process
GO:0032501	0.401	multicellular organismal process
GO:0032502	0.388	developmental process
GO:0048856	0.375	anatomical structure development
GO:0007275	0.308	multicellular organism development
GO:0071704	0.305	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005747	0.996	mitochondrial respiratory chain complex I
GO:0043233	0.309	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]