StarFunc result for job id O43182

User Input

>input (974 residues)
MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGSDEAGAEGSARGA
TAGRLYSPSLPAESLGPRLASSSRGPPPRATRLPPPGPLCSSFSTPSTPQEKSPSGSFHF
DYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQ
SPPDSRGHPYVVWKSEGDFTWNSMSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDCD
LSCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAFGMPLSQVIANDRAYKLKQDL
QRDEQKDASDFVASLLPFGNKRQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARRRG
AMSVDSITDLDDNQSRLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQH
LEKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLRDMPDPL
LTRELYTAFINTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVARHADDNISKD
GQEVTGNKMTSLNLATIFGPNLLHKQKSSDKEFSVQSSARAEESTAIIAVVQKMIENYEA
LFMVPPDLQNEVLISLLETDPDVVDYLLRRKASQSSSPDMLQSEVSFSVGGRHSSTDSNK
ASSGDISPYDNNSPVLSERSLLAMQEDAAPGGSEKLYRVPGQFMLVGHLSSSKSRESSPG
PRLGKDLSEEPFDIWGTWHSTLKSGSKDPGMTGSSGDIFESSSLRAGPCSLSQGNLSPNW
PRWQGSPAELDSDTQGARRTQAAAPATEGRAHPAVSRACSTPHVQVAGKAERPTARSEQY
LTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPYPGPGKPAAAAAWIQGP
PEGVETPTDQGGQAAEREQQVTQKKLSSANSLPAGEQDSPRLGDAGWLDWQRERWQIWEL
LSTDNPDALPETLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43182	1.000	1.000	0.000	974	1.000	1.000	O43182.pdb.gz	RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=3
2	AFDB:O54834	0.592	0.585	3.483E-104	987	0.861	0.850	O54834.pdb.gz	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3
3	AFDB:H7BYE6	0.413	0.655	8.002E-71	601	0.551	0.894	H7BYE6.pdb.gz	H7BYE6_HUMAN Rho GTPase activating protein 6 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
4	AFDB:Q6DFV3	0.176	0.089	1.218E-13	1944	0.169	0.085	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
5	AFDB:Q5T5U3	0.176	0.089	2.620E-13	1958	0.164	0.082	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
6	AFDB:X2JEI9	0.172	0.079	1.392E-11	2206	0.184	0.081	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
7	PDB:6r3vA	0.169	0.798	3.278E-11	198	0.054	0.268	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
8	PDB:3cxlA	0.170	0.401	1.307E-9	402	0.057	0.139	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
9	PDB:1xa6A	0.172	0.408	1.741E-9	399	0.053	0.130	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
10	PDB:5c2kA	0.168	0.411	4.121E-9	382	0.052	0.134	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
11	AFDB:D4A9G6	0.194	0.146	7.355E-9	1310	0.189	0.140	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
12	AFDB:F1MAK3	0.190	0.091	1.306E-8	2101	0.138	0.064	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
13	AFDB:Q6P4F7	0.188	0.179	1.508E-8	1023	0.109	0.104	Q6P4F7.pdb.gz	RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens OX=9606 GN=ARHGAP11A PE=1 SV=2
14	PDB:5jcpA	0.168	0.443	1.732E-8	361	0.060	0.161	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	AFDB:A7KAX9	0.184	0.087	1.826E-8	2087	0.144	0.067	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
16	PDB:7oseB	0.052	0.105	4.786E-1	377	0.032	0.082	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
17	PDB:5k1vB	0.046	0.051	6.080E-1	849	0.032	0.037	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
18	PDB:6sgaFA	0.047	0.069	8.500E-1	579	0.031	0.052	6sgaFA.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
19	PDB:7d5sRN	0.053	0.075	9.813E-1	607	0.068	0.109	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:7tvzA	0.045	0.050	1.308	850	0.039	0.045	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DN07	0.0	1138	604	0.573	0.924	B4DN07_HUMAN Rho GTPase activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
2	H7BYE6	0.0	1073	601	0.544	0.882	H7BYE6_HUMAN Rho GTPase activating protein 6 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
3	O43182	0.0	1975	974	1.000	1.000	RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=3
4	O54834	0.0	1549	987	0.859	0.848	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3
5	O01443	2.38e-41	167	986	0.098	0.096	O01443_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-6 PE=4 SV=3
6	O43052	1.66e-22	106	1150	0.077	0.065	RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga1 PE=1 SV=1
7	Q5FWK3	4.48e-21	99.8	439	0.053	0.118	RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arhgap1 PE=1 SV=1
8	Q6DFV3	1.10e-20	101	1945	0.061	0.030	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
9	Q5T5U3	1.18e-20	101	1958	0.061	0.030	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
10	J3JSM9	1.43e-20	100	1406	0.061	0.042	J3JSM9_HUMAN ARHGAP21 protein OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1
11	A0A087WW76	1.51e-20	100	1406	0.061	0.042	A0A087WW76_HUMAN Rho GTPase activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1
12	Q9P227	1.67e-20	100	1491	0.062	0.040	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
13	O43295	2.78e-20	99.4	1099	0.065	0.057	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
14	Q1RLN5	3.92e-20	98.6	799	0.051	0.063	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
15	O94988	4.07e-20	99.0	1023	0.073	0.069	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
16	Q8IWW6	4.16e-20	98.6	846	0.051	0.059	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
17	A0A0G2JYR5	5.55e-20	97.1	512	0.053	0.102	A0A0G2JYR5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
18	A0A8I6A7T6	6.34e-20	95.9	410	0.053	0.127	A0A8I6A7T6_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
19	Q07960	1.20e-19	95.1	439	0.057	0.128	RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1
20	D4A6C5	1.91e-19	94.7	439	0.053	0.118	D4A6C5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05547 Peptidase_M6	6.2e+02	10.1	Immune inhibitor A peptidase M6
2	PF00620 RhoGAP	2.5e-42	155.7	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.949	Transforming protein RhoA
2	9606.ENSP00000348461	0.920	Ras-related C3 botulinum toxin substrate 1
3	9606.ENSP00000407586	0.917	GTPase HRas
4	9606.ENSP00000357048	0.916	Coatomer subunit alpha
5	9606.ENSP00000440005	0.912	ADP-ribosylation factor 1
6	9606.ENSP00000242285	0.900	Clathrin light chain A
7	9606.ENSP00000258739	0.900	ER lumen protein-retaining receptor 2
8	9606.ENSP00000309415	0.900	Clathrin light chain B
9	9606.ENSP00000329471	0.900	ER lumen protein-retaining receptor 1
10	9606.ENSP00000386918	0.900	ER lumen protein-retaining receptor 3
11	9606.ENSP00000326579	0.866	Cytochrome c-type heme lyase
12	9606.ENSP00000455434	0.713	Protein RD3-like
13	9606.ENSP00000350409	0.704	Protein unc-50 homolog
14	9606.ENSP00000312244	0.690	Male-specific lethal 3 homolog
15	9606.ENSP00000324827	0.687	A-kinase anchor protein 17A
16	9606.ENSP00000378058	0.680	EGF-containing fibulin-like extracellular matrix protein 1
17	9606.ENSP00000261883	0.675	Cartilage intermediate layer protein 1
18	9606.ENSP00000245304	0.664	Ras-related protein Rap-2a
19	9606.ENSP00000355731	0.661	Serine/threonine-protein kinase MRCK alpha
20	9606.ENSP00000482128	0.655	Cytoplasmic polyadenylation element-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0019899	0.977	enzyme binding
GO:0043274	0.971	phospholipase binding
GO:0060229	0.866	lipase activator activity
GO:0016004	0.851	phospholipase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0051336	0.965	regulation of hydrolase activity
GO:0010646	0.965	regulation of cell communication
GO:0023051	0.962	regulation of signaling
GO:0050896	0.952	response to stimulus
GO:0051056	0.929	regulation of small GTPase mediated signal transduction
GO:0023052	0.893	signaling
GO:0007154	0.892	cell communication
GO:0051716	0.883	cellular response to stimulus
GO:0044093	0.872	positive regulation of molecular function
GO:0007165	0.838	signal transduction
GO:0048519	0.637	negative regulation of biological process
GO:0051128	0.603	regulation of cellular component organization
GO:0043085	0.585	positive regulation of catalytic activity
GO:0051345	0.581	positive regulation of hydrolase activity
GO:0048523	0.568	negative regulation of cellular process
GO:0007264	0.379	small GTPase mediated signal transduction
GO:0071840	0.352	cellular component organization or biogenesis
GO:0032956	0.337	regulation of actin cytoskeleton organization
GO:0016043	0.322	cellular component organization
GO:0030155	0.316	regulation of cell adhesion
GO:0044087	0.303	regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043229	0.945	intracellular organelle
GO:0043227	0.471	membrane-bounded organelle
GO:0043231	0.455	intracellular membrane-bounded organelle
GO:0016020	0.388	membrane
GO:0043232	0.342	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]