StarFunc result for job id O43187

User Input

>input (625 residues)
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43187	1.000	1.000	1.957E-100	625	1.000	1.000	O43187.pdb.gz	IRAK2_HUMAN Interleukin-1 receptor-associated kinase-like 2 OS=Homo sapiens OX=9606 GN=IRAK2 PE=1 SV=2
2	AFDB:Q8CFA1	0.566	0.569	6.753E-70	622	0.696	0.699	Q8CFA1.pdb.gz	IRAK2_MOUSE Interleukin-1 receptor-associated kinase-like 2 OS=Mus musculus OX=10090 GN=Irak2 PE=2 SV=2
3	AFDB:Q4QQS0	0.604	0.605	1.009E-69	624	0.710	0.712	Q4QQS0.pdb.gz	IRAK2_RAT Interleukin-1 receptor-associated kinase-like 2 OS=Rattus norvegicus OX=10116 GN=Irak2 PE=2 SV=1
4	AFDB:P51617	0.452	0.400	5.511E-33	712	0.296	0.260	P51617.pdb.gz	IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2
5	AFDB:B2RYH5	0.446	0.398	4.550E-32	710	0.309	0.272	B2RYH5.pdb.gz	B2RYH5_RAT Interleukin-1 receptor-associated kinase 1 (Predicted) OS=Rattus norvegicus OX=10116 GN=Irak1 PE=2 SV=1
6	AFDB:Q8K4B2	0.429	0.440	2.030E-27	609	0.253	0.259	Q8K4B2.pdb.gz	IRAK3_MOUSE Interleukin-1 receptor-associated kinase 3 OS=Mus musculus OX=10090 GN=Irak3 PE=1 SV=2
7	AFDB:Q9Y616	0.423	0.443	8.370E-26	596	0.232	0.243	Q9Y616.pdb.gz	IRAK3_HUMAN Interleukin-1 receptor-associated kinase 3 OS=Homo sapiens OX=9606 GN=IRAK3 PE=1 SV=2
8	AFDB:Q6IWL3	0.446	0.570	5.209E-23	483	0.186	0.240	Q6IWL3.pdb.gz
9	AFDB:F4HSH9	0.405	0.468	2.043E-21	538	0.158	0.184	F4HSH9.pdb.gz	F4HSH9_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g07870 PE=1 SV=1
10	AFDB:Q7Y229	0.413	0.518	1.961E-20	492	0.158	0.201	Q7Y229.pdb.gz	Q7Y229_ARATH At1g56720 OS=Arabidopsis thaliana OX=3702 GN=At1g56720 PE=1 SV=1
11	PDB:8dksA	0.398	0.848	2.147E-19	283	0.131	0.290	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:2qkwB	0.394	0.804	2.867E-15	292	0.128	0.274	2qkwB.pdb.gz
13	PDB:5tosA	0.374	0.806	1.446E-13	280	0.106	0.236	5tosA.pdb.gz
14	PDB:6j5tH	0.375	0.681	1.320E-12	327	0.112	0.214	6j5tH.pdb.gz	Reconstitution and structure of a plant NLR resistosome conferring immunity.
15	PDB:6j5wB	0.366	0.711	3.641E-11	306	0.115	0.235	6j5wB.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
16	PDB:5u6yA	0.306	0.404	1.046E-10	459	0.106	0.144	5u6yA.pdb.gz
17	PDB:1k9aB	0.300	0.417	1.279E-10	441	0.086	0.122	1k9aB.pdb.gz
18	PDB:2h8hA	0.298	0.405	1.912E-10	445	0.106	0.148	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:4krcA	0.330	0.645	1.912E-10	297	0.085	0.178	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:7myjC	0.298	0.392	1.912E-10	465	0.094	0.127	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43187	0.0	1293	625	1.000	1.000	IRAK2_HUMAN Interleukin-1 receptor-associated kinase-like 2 OS=Homo sapiens OX=9606 GN=IRAK2 PE=1 SV=2
2	Q4QQS0	0.0	893	624	0.712	0.713	IRAK2_RAT Interleukin-1 receptor-associated kinase-like 2 OS=Rattus norvegicus OX=10116 GN=Irak2 PE=2 SV=1
3	Q8CFA1	0.0	871	622	0.696	0.699	IRAK2_MOUSE Interleukin-1 receptor-associated kinase-like 2 OS=Mus musculus OX=10090 GN=Irak2 PE=2 SV=2
4	A0A0G2JYX9	1.92e-65	229	711	0.286	0.252	A0A0G2JYX9_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
5	B2RYH5	8.47e-65	228	710	0.280	0.246	B2RYH5_RAT Interleukin-1 receptor-associated kinase 1 (Predicted) OS=Rattus norvegicus OX=10116 GN=Irak1 PE=2 SV=1
6	A0A8I6AR42	1.15e-64	228	709	0.280	0.247	A0A8I6AR42_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
7	Q62406	1.16e-61	219	710	0.280	0.246	IRAK1_MOUSE Interleukin-1 receptor-associated kinase 1 OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=3
8	P51617	1.53e-61	219	712	0.302	0.265	IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2
9	Q99J34	3.62e-56	204	717	0.253	0.220	Q99J34_MOUSE Irak1 protein OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=1
10	A0A8I5ZRN5	2.81e-55	200	631	0.216	0.214	A0A8I5ZRN5_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
11	Q8K4B2	6.90e-43	165	609	0.211	0.217	IRAK3_MOUSE Interleukin-1 receptor-associated kinase 3 OS=Mus musculus OX=10090 GN=Irak3 PE=1 SV=2
12	D4A7K4	1.76e-38	150	455	0.189	0.259	D4A7K4_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=2
13	A0A8I6G1H3	1.93e-38	150	461	0.189	0.256	A0A8I6G1H3_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=1
14	Q8R4K2	9.68e-38	148	459	0.194	0.264	IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus OX=10090 GN=Irak4 PE=1 SV=1
15	Q69FE3	5.04e-37	145	460	0.174	0.237	Q69FE3_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
16	Q9NWZ3	5.04e-37	145	460	0.174	0.237	IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
17	Q9Y616	4.44e-33	136	596	0.149	0.156	IRAK3_HUMAN Interleukin-1 receptor-associated kinase 3 OS=Homo sapiens OX=9606 GN=IRAK3 PE=1 SV=2
18	B0UYS2	3.77e-32	134	630	0.122	0.121	B0UYS2_DANRE Interleukin-1 receptor-associated kinase 3 OS=Danio rerio OX=7955 GN=irak3 PE=4 SV=1
19	Q84M95	1.53e-29	122	375	0.123	0.205	PBL28_ARATH Probable serine/threonine-protein kinase PBL28 OS=Arabidopsis thaliana OX=3702 GN=PBL28 PE=2 SV=1
20	Q05652	2.93e-28	120	501	0.194	0.242	KPEL_DROME Serine/threonine-protein kinase pelle OS=Drosophila melanogaster OX=7227 GN=pll PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	1.1e-06	40.0	Death domain
2	PF00069 Pkinase	1.7e-23	95.0	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.5e-19	81.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.999	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
3	9606.ENSP00000390651	0.996	Interleukin-1 receptor-associated kinase 4
4	9606.ENSP00000376445	0.994	Toll/interleukin-1 receptor domain-containing adapter protein
5	9606.ENSP00000386380	0.988	Interleukin-1 receptor type 1
6	9606.ENSP00000358997	0.980	Interleukin-1 receptor-associated kinase 1
7	9606.ENSP00000363089	0.978	Toll-like receptor 4
8	9606.ENSP00000261233	0.977	Interleukin-1 receptor-associated kinase 3
9	9606.ENSP00000314733	0.976	Toll-interacting protein
10	9606.ENSP00000260010	0.966	Toll-like receptor 2
11	9606.ENSP00000354932	0.956	Toll-like receptor 1
12	9606.ENSP00000314807	0.953	Interleukin 1 receptor accessory protein
13	9606.ENSP00000263341	0.952	Interleukin-1 beta
14	9606.ENSP00000359424	0.949	Inhibitor of nuclear factor kappa-B kinase subunit alpha
15	9606.ENSP00000483825	0.949	NF-kappa-B essential modulator
16	9606.ENSP00000284818	0.942	Lymphocyte antigen 96
17	9606.ENSP00000263339	0.940	Interleukin-1 alpha
18	9606.ENSP00000345083	0.928	Dual specificity mitogen-activated protein kinase kinase 3
19	9606.ENSP00000468348	0.928	Dual specificity mitogen-activated protein kinase kinase 6
20	9606.ENSP00000259206	0.926	Interleukin-1 receptor antagonist protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.984	identical protein binding
GO:0003824	0.920	catalytic activity
GO:0046983	0.907	protein dimerization activity
GO:0016740	0.866	transferase activity
GO:0046982	0.797	protein heterodimerization activity
GO:0016301	0.775	kinase activity
GO:0140096	0.744	catalytic activity, acting on a protein
GO:0016773	0.737	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.712	protein kinase activity
GO:0042803	0.628	protein homodimerization activity
GO:0004674	0.360	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0051716	0.985	cellular response to stimulus
GO:0050794	0.982	regulation of cellular process
GO:0042221	0.975	response to chemical
GO:0010033	0.971	response to organic substance
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0010468	0.970	regulation of gene expression
GO:0007165	0.967	signal transduction
GO:0048518	0.965	positive regulation of biological process
GO:0006950	0.960	response to stress
GO:0008152	0.956	metabolic process
GO:0051092	0.951	positive regulation of NF-kappaB transcription factor activity
GO:0071704	0.943	organic substance metabolic process
GO:0009966	0.939	regulation of signal transduction
GO:0002376	0.931	immune system process
GO:0070887	0.918	cellular response to chemical stimulus
GO:0044238	0.916	primary metabolic process
GO:0006807	0.916	nitrogen compound metabolic process
GO:0071310	0.909	cellular response to organic substance
GO:0043170	0.908	macromolecule metabolic process
GO:0002221	0.905	pattern recognition receptor signaling pathway
GO:0044237	0.904	cellular metabolic process
GO:0009607	0.897	response to biotic stimulus
GO:0009605	0.889	response to external stimulus
GO:0007166	0.886	cell surface receptor signaling pathway
GO:1901564	0.883	organonitrogen compound metabolic process
GO:0002237	0.883	response to molecule of bacterial origin
GO:0034097	0.876	response to cytokine
GO:0019221	0.870	cytokine-mediated signaling pathway
GO:0071216	0.864	cellular response to biotic stimulus
GO:0071396	0.862	cellular response to lipid
GO:0019538	0.848	protein metabolic process
GO:0002224	0.848	toll-like receptor signaling pathway
GO:0006468	0.840	protein phosphorylation
GO:0048522	0.839	positive regulation of cellular process
GO:0060759	0.832	regulation of response to cytokine stimulus
GO:1901701	0.825	cellular response to oxygen-containing compound
GO:0044092	0.801	negative regulation of molecular function
GO:0035556	0.730	intracellular signal transduction
GO:0001959	0.709	regulation of cytokine-mediated signaling pathway
GO:0009893	0.695	positive regulation of metabolic process
GO:0006952	0.693	defense response
GO:0043433	0.679	negative regulation of DNA-binding transcription factor activity
GO:0071219	0.673	cellular response to molecule of bacterial origin
GO:0010604	0.661	positive regulation of macromolecule metabolic process
GO:0032088	0.629	negative regulation of NF-kappaB transcription factor activity
GO:0070555	0.622	response to interleukin-1
GO:1902531	0.586	regulation of intracellular signal transduction
GO:0051239	0.536	regulation of multicellular organismal process
GO:0023056	0.486	positive regulation of signaling
GO:0010647	0.486	positive regulation of cell communication
GO:0009967	0.480	positive regulation of signal transduction
GO:0001817	0.415	regulation of cytokine production
GO:0048519	0.407	negative regulation of biological process
GO:0051173	0.369	positive regulation of nitrogen compound metabolic process
GO:0043122	0.363	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0007249	0.341	I-kappaB kinase/NF-kappaB signaling
GO:1902533	0.331	positive regulation of intracellular signal transduction
GO:0071347	0.330	cellular response to interleukin-1

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.984	membrane
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0012505	0.935	endomembrane system
GO:0071944	0.924	cell periphery
GO:0005886	0.881	plasma membrane
GO:0031410	0.777	cytoplasmic vesicle
GO:0031090	0.684	organelle membrane
GO:0098588	0.585	bounding membrane of organelle
GO:0005768	0.557	endosome
GO:0030659	0.523	cytoplasmic vesicle membrane
GO:0010008	0.472	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.866	Transferases.
EC:2.7.-.-	0.775	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.737	Phosphotransferases with an alcohol group as acceptor.

[back to server]