StarFunc result for job id O43189

User Input

>input (567 residues)
MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREV
CLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHV
PRAPAPGEGEGTSWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGH
LSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGG
PEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGE
RSSRLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTSFPSGQGPGGG
VSRPLGKRRRPEPEPLRRRQKGKVEELGPPSAVRNQPEPQEQRERAHLQRALQASVSPPS
PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPPDRSPLELHIG
FPTDIPKSAPHSMTASSSSVSSPSPGLPRRSAPPSPLCRSLSPGTGGGVRGGVGYLSRGD
PVRVLARRVRPDGSVQYLVEWGGGGIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43189	1.000	1.000	0.000	567	1.000	1.000	O43189.pdb.gz	PHF1_HUMAN PHD finger protein 1 OS=Homo sapiens OX=9606 GN=PHF1 PE=1 SV=3
2	AFDB:A0A1U9X8A3	0.591	0.731	5.848E-72	457	0.656	0.814	A0A1U9X8A3.pdb.gz	A0A1U9X8A3_HUMAN PHF1 OS=Homo sapiens OX=9606 PE=3 SV=1
3	AFDB:F8W2W1	0.105	0.066	6.977E-3	1078	0.153	0.081	F8W2W1.pdb.gz
4	PDB:3mp8A	0.087	0.096	3.491E-2	513	0.019	0.021	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
5	PDB:5z8lA	0.078	0.194	3.923E-2	204	0.042	0.118	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
6	PDB:7nkxZ	0.084	0.288	4.673E-2	156	0.014	0.051	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
7	PDB:3p8bB	0.091	0.332	7.899E-2	147	0.016	0.061	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
8	PDB:1k9aB	0.083	0.105	8.876E-2	441	0.030	0.039	1k9aB.pdb.gz
9	PDB:7r1dC	0.085	0.243	9.974E-2	192	0.021	0.062	7r1dC.pdb.gz
10	PDB:4zn3A	0.090	0.329	1.057E-1	147	0.012	0.048	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
11	AFDB:A0A2R8RZV0	0.095	0.055	1.082E-1	1059	0.160	0.086	A0A2R8RZV0.pdb.gz
12	AFDB:O54826	0.102	0.059	1.216E-1	1068	0.178	0.095	O54826.pdb.gz	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
13	PDB:7abi7	0.086	0.199	1.260E-1	236	0.016	0.038	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	PDB:8dmbP	0.091	0.153	1.500E-1	328	0.018	0.030	8dmbP.pdb.gz	Structure of the OMEGA nickase IsrB in complex with omega RNA and target DNA.
15	PDB:4v6iBN	0.089	0.298	1.686E-1	138	0.021	0.087	4v6iBN.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
16	AFDB:Q9C009	0.110	0.148	6.995E-1	403	0.090	0.127	Q9C009.pdb.gz	FOXQ1_HUMAN Forkhead box protein Q1 OS=Homo sapiens OX=9606 GN=FOXQ1 PE=2 SV=2
17	AFDB:A0A0B4JDC9	0.111	0.046	9.364E-1	1844	0.134	0.041	A0A0B4JDC9.pdb.gz	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
18	AFDB:F8W451	0.108	0.059	9.926E-1	1133	0.173	0.086	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
19	AFDB:A0A024R8E2	0.104	0.068	1.408	1130	0.169	0.085	A0A024R8E2.pdb.gz
20	AFDB:O54743	0.113	0.138	1.678	446	0.095	0.121	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K557	0.0	1033	600	0.929	0.878	A0A0G2K557_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=3 SV=1
2	A0A1U9X8A3	0.0	725	457	0.621	0.770	A0A1U9X8A3_HUMAN PHF1 OS=Homo sapiens OX=9606 PE=3 SV=1
3	O43189	0.0	1145	567	1.000	1.000	PHF1_HUMAN PHD finger protein 1 OS=Homo sapiens OX=9606 GN=PHF1 PE=1 SV=3
4	Q5XI49	0.0	702	412	0.607	0.835	Q5XI49_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=1 SV=1
5	Q6MGC9	0.0	1019	560	0.929	0.941	Q6MGC9_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=3 SV=1
6	Q9Z1B8	0.0	1005	559	0.924	0.937	PHF1_MOUSE PHD finger protein 1 OS=Mus musculus OX=10090 GN=Phf1 PE=1 SV=2
7	Q02395	2.36e-137	413	593	0.404	0.386	MTF2_MOUSE Metal-response element-binding transcription factor 2 OS=Mus musculus OX=10090 GN=Mtf2 PE=1 SV=2
8	Q9Y483	1.78e-136	411	593	0.402	0.384	MTF2_HUMAN Metal-response element-binding transcription factor 2 OS=Homo sapiens OX=9606 GN=MTF2 PE=1 SV=3
9	Q5T6S3	1.41e-126	385	580	0.406	0.397	PHF19_HUMAN PHD finger protein 19 OS=Homo sapiens OX=9606 GN=PHF19 PE=1 SV=1
10	Q9CXG9	1.79e-121	372	578	0.344	0.337	PHF19_MOUSE PHD finger protein 19 OS=Mus musculus OX=10090 GN=Phf19 PE=1 SV=1
11	B4DZG1	2.44e-111	343	491	0.344	0.397	B4DZG1_HUMAN Metal response element binding transcription factor 2, isoform CRA_c OS=Homo sapiens OX=9606 GN=MTF2 PE=1 SV=1
12	F7ELX2	1.60e-58	197	239	0.198	0.469	F7ELX2_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=4 SV=1
13	Q24459	2.20e-44	171	1043	0.185	0.101	PCL_DROME Polycomb protein Pcl OS=Drosophila melanogaster OX=7227 GN=Pcl PE=1 SV=2
14	Q55AQ4	2.19e-15	82.0	988	0.069	0.039	Q55AQ4_DICDI B30.2/SPRY domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271754 PE=4 SV=1
15	O60070	6.01e-07	54.7	652	0.069	0.060	ASH2_SCHPO Set1 complex component ash2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ash2 PE=3 SV=1
16	Q8CID0	1.65e-06	53.5	779	0.058	0.042	CSR2B_MOUSE Cysteine-rich protein 2-binding protein OS=Mus musculus OX=10090 GN=Kat14 PE=1 SV=2
17	Q96CB8	4.30e-06	51.6	462	0.037	0.045	INT12_HUMAN Integrator complex subunit 12 OS=Homo sapiens OX=9606 GN=INTS12 PE=1 SV=1
18	Q92613	1.03e-05	50.8	823	0.055	0.038	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
19	Q9H8E8	1.90e-05	50.1	782	0.056	0.041	CSR2B_HUMAN Cysteine-rich protein 2-binding protein OS=Homo sapiens OX=9606 GN=KAT14 PE=1 SV=3
20	G3XAA4	2.53e-05	49.7	834	0.049	0.034	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	42	15.5	Chromo (CHRromatin Organisation MOdifier) domain
2	PF15057 DUF4537	16	16.9	Domain of unknown function (DUF4537)
3	PF14061 Mtf2_C	4.9e-05	34.8	Polycomb-like MTF2 factor 2
4	PF00628 PHD	4.6e-08	44.2	PHD-finger
5	PF13831 PHD_2	4.2	18.2	PHD-finger
6	PF18104 Tudor_2	3.7e-11	53.8	Jumonji domain-containing protein 2A Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363640

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320147	0.999	Histone-lysine N-methyltransferase EZH2
2	9606.ENSP00000316578	0.988	Polycomb protein SUZ12
3	9606.ENSP00000263360	0.979	Polycomb protein EED
4	9606.ENSP00000369424	0.973	Histone-binding protein RBBP7
5	9606.ENSP00000362592	0.959	Histone-binding protein RBBP4
6	9606.ENSP00000404658	0.895	Histone-lysine N-methyltransferase EZH1
7	9606.ENSP00000341280	0.881	Protein Jumonji
8	9606.ENSP00000381840	0.872	Zinc finger protein AEBP2
9	9606.ENSP00000352257	0.835	X-ray repair cross-complementing protein 6
10	9606.ENSP00000283928	0.809	Juxtaposed with another zinc finger protein 1
11	9606.ENSP00000340820	0.804	Microtubule-associated protein tau
12	9606.ENSP00000366876	0.801	PHD finger protein 13
13	9606.ENSP00000269305	0.798	Cellular tumor antigen p53
14	9606.ENSP00000360138	0.761	Ligand-dependent corepressor
15	9606.ENSP00000356520	0.753	ATP-dependent RNA helicase A
16	9606.ENSP00000484710	0.749	Scaffold protein that serves as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex: required to fine- tune the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells (ESCs). Plays a key role in genomic regions that display both active and repressive chromatin properties in pluripotent stem cells by sustaining low level expression at PcG target genes: acts by recruiting the elongin BC complex, thereby restricting excessive activity of the PRC2/EED-EZH2 complex. Interaction with USP7 promotes deubiquitination of H2B at promoter si [...]
17	9606.ENSP00000355657	0.735	Histone H3.1t
18	9606.ENSP00000352516	0.727	DNA (cytosine-5)-methyltransferase 1
19	9606.ENSP00000363624	0.716	Protein CutA
20	9606.ENSP00000420211	0.708	Ral guanine nucleotide dissociation stimulator-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.999	methylated histone binding
GO:0008134	0.996	transcription factor binding
GO:1990226	0.938	histone methyltransferase binding
GO:0042802	0.919	identical protein binding
GO:0001222	0.915	transcription corepressor binding
GO:1901363	0.610	heterocyclic compound binding
GO:0003682	0.594	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0009987	0.992	cellular process
GO:0050896	0.980	response to stimulus
GO:0031399	0.977	regulation of protein modification process
GO:0031060	0.971	regulation of histone methylation
GO:0010604	0.969	positive regulation of macromolecule metabolic process
GO:0006950	0.968	response to stress
GO:0048519	0.965	negative regulation of biological process
GO:0051247	0.958	positive regulation of protein metabolic process
GO:0031325	0.957	positive regulation of cellular metabolic process
GO:0051716	0.942	cellular response to stimulus
GO:0009892	0.941	negative regulation of metabolic process
GO:0031062	0.936	positive regulation of histone methylation
GO:0051172	0.929	negative regulation of nitrogen compound metabolic process
GO:0031324	0.929	negative regulation of cellular metabolic process
GO:0010605	0.928	negative regulation of macromolecule metabolic process
GO:0031400	0.836	negative regulation of protein modification process
GO:0031057	0.809	negative regulation of histone modification
GO:0033554	0.684	cellular response to stress
GO:0010468	0.508	regulation of gene expression
GO:0019219	0.440	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.437	regulation of macromolecule biosynthetic process
GO:0031326	0.437	regulation of cellular biosynthetic process
GO:0006355	0.425	regulation of DNA-templated transcription
GO:0006974	0.363	cellular response to DNA damage stimulus
GO:0071704	0.336	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0140513	0.890	nuclear protein-containing complex
GO:1902494	0.869	catalytic complex
GO:0043232	0.841	intracellular non-membrane-bounded organelle
GO:1990234	0.824	transferase complex
GO:0031519	0.723	PcG protein complex
GO:0035097	0.720	histone methyltransferase complex
GO:0005737	0.662	cytoplasm
GO:0035098	0.662	ESC/E(Z) complex
GO:0005694	0.643	chromosome
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]