StarFunc result for job id O43248

User Input

>input (304 residues)
MFNSVNLGNFCSPSRKERGADFGERGSCASNLYLPSCTYYMPEFSTVSSFLPQAPSRQIS
YPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGS
YGGHHHPSAPHATPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDPPAEPPCSGKGEAKGE
PEAPPASGLASRAEAGAEAEAEEENTNPSSSGSAHSVAKEPAKGAAPNAPRTRKKRCPYS
KFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRDRLQYFSG
NPLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43248	0.999	0.999	2.732E-44	304	1.000	1.000	O43248.pdb.gz	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
2	AFDB:P31275	0.230	0.247	1.083E-8	282	0.289	0.312	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
3	AFDB:P31276	0.213	0.197	2.482E-7	330	0.257	0.236	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
4	AFDB:Q6JIY5	0.207	0.206	6.310E-7	306	0.234	0.232	Q6JIY5.pdb.gz	HXCDA_DANRE Homeobox protein Hox-C13a OS=Danio rerio OX=7955 GN=hoxc13a PE=2 SV=1
5	AFDB:P97503	0.228	0.209	1.653E-5	333	0.234	0.213	P97503.pdb.gz	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
6	AFDB:P82976	0.214	0.158	4.201E-5	418	0.217	0.158	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
7	AFDB:P10105	0.200	0.103	2.223E-4	635	0.204	0.098	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
8	AFDB:P22808	0.210	0.094	2.540E-4	723	0.250	0.105	P22808.pdb.gz	VND_DROME Homeobox protein vnd OS=Drosophila melanogaster OX=7227 GN=vnd PE=1 SV=3
9	AFDB:A6YP92	0.225	0.124	5.651E-4	566	0.207	0.111	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
10	AFDB:P83949	0.235	0.189	5.651E-4	389	0.214	0.167	P83949.pdb.gz	UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster OX=7227 GN=Ubx PE=1 SV=1
11	PDB:4egcA	0.156	0.088	1.224E-2	539	0.043	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.164	0.584	1.646E-1	73	0.046	0.192	2hi3A.pdb.gz
13	PDB:7fbyA	0.124	0.225	5.464E-1	153	0.033	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.134	0.395	1.485	86	0.030	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5nr5A	0.127	0.306	1.485	113	0.046	0.124	5nr5A.pdb.gz
16	PDB:2cjjA	0.126	0.453	2.214	63	0.033	0.159	2cjjA.pdb.gz
17	PDB:2cg4A	0.129	0.242	3.531	149	0.016	0.034	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
18	PDB:2h09A	0.081	0.177	4.609	127	0.023	0.055	2h09A.pdb.gz
19	PDB:5mrca	0.115	0.185	4.609	177	0.046	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
20	PDB:7qsmW	0.086	0.198	4.609	116	0.033	0.086	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43248	0.0	627	304	1.000	1.000	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
2	P31313	0.0	616	304	0.977	0.977	HXC11_MOUSE Homeobox protein Hox-C11 OS=Mus musculus OX=10090 GN=Hoxc11 PE=2 SV=3
3	J3KMZ0	1.51e-164	464	378	0.773	0.622	J3KMZ0_HUMAN Homeobox C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
4	B2RYB5	7.99e-86	261	313	0.530	0.514	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
5	P31277	6.42e-61	199	338	0.474	0.426	HXD11_HUMAN Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3
6	P23813	3.90e-55	183	323	0.457	0.430	HXD11_MOUSE Homeobox protein Hox-D11 OS=Mus musculus OX=10090 GN=Hoxd11 PE=2 SV=2
7	H0YIA6	8.23e-43	150	283	0.224	0.240	H0YIA6_HUMAN Homeobox A11 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA11 PE=1 SV=1
8	P31270	2.29e-42	150	313	0.224	0.217	HXA11_HUMAN Homeobox protein Hox-A11 OS=Homo sapiens OX=9606 GN=HOXA11 PE=2 SV=2
9	G3V6Z0	2.44e-42	150	313	0.224	0.217	G3V6Z0_RAT Homeobox A11 OS=Rattus norvegicus OX=10116 GN=Hoxa11 PE=3 SV=1
10	P31311	2.63e-42	150	313	0.224	0.217	HXA11_MOUSE Homeobox protein Hox-A11 OS=Mus musculus OX=10090 GN=Hoxa11 PE=1 SV=2
11	P31257	5.10e-26	107	342	0.188	0.167	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
12	P31310	7.19e-26	108	416	0.201	0.147	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
13	Q53XI4	2.67e-25	105	342	0.178	0.158	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
14	Q9NYD6	2.67e-25	105	342	0.178	0.158	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
15	P31260	4.62e-25	105	410	0.197	0.146	HXA10_HUMAN Homeobox protein Hox-A10 OS=Homo sapiens OX=9606 GN=HOXA10 PE=1 SV=3
16	A0A669KBC8	8.86e-25	101	213	0.135	0.192	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
17	A0A669K9T0	1.51e-24	100	225	0.135	0.182	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
18	P09631	1.76e-24	101	271	0.135	0.151	HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus OX=10090 GN=Hoxa9 PE=1 SV=2
19	D3ZSU5	1.81e-24	101	271	0.135	0.151	D3ZSU5_RAT Homeobox protein OS=Rattus norvegicus OX=10116 GN=Hoxa9 PE=3 SV=1
20	P31269	2.11e-24	101	272	0.135	0.151	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12045 DUF3528	9.9e-44	160.7	Protein of unknown function (DUF3528)
2	PF05920 Homeobox_KN	2e+02	13.3	Homeobox KN domain
3	PF00046 Homeodomain	4.8e-16	69.7	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446680

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240335	0.794	T-box transcription factor TBX4
2	9606.ENSP00000362680	0.712	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000309913	0.684	T-box transcription factor TBX5
4	9606.ENSP00000243056	0.656	Homeobox protein Hox-C13
5	9606.ENSP00000307321	0.638	Homeobox protein Hox-C10
6	9606.ENSP00000254846	0.617	Lysine-specific demethylase 6B
7	9606.ENSP00000378650	0.593	T-box transcription factor TBX6
8	9606.ENSP00000257566	0.592	T-box transcription factor TBX3
9	9606.ENSP00000451207	0.577	Double homeobox 4 like 1
10	9606.ENSP00000240328	0.570	T-box transcription factor TBX2
11	9606.ENSP00000264162	0.537	Lactase-phlorizin hydrolase
12	9606.ENSP00000451411	0.528	Double homeobox 4 like 7
13	9606.ENSP00000458065	0.528	Double homeobox protein 4
14	9606.ENSP00000485452	0.514	Double homeodomain protein DUX4-s
15	9606.ENSP00000304502	0.508	Homeobox protein SIX2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.976	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0032502	0.989	developmental process
GO:0050789	0.988	regulation of biological process
GO:0007275	0.984	multicellular organism development
GO:0009653	0.980	anatomical structure morphogenesis
GO:0050794	0.978	regulation of cellular process
GO:0048513	0.974	animal organ development
GO:0048731	0.934	system development
GO:0019222	0.917	regulation of metabolic process
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0010468	0.889	regulation of gene expression
GO:0048518	0.888	positive regulation of biological process
GO:0080090	0.859	regulation of primary metabolic process
GO:0051171	0.859	regulation of nitrogen compound metabolic process
GO:0031323	0.859	regulation of cellular metabolic process
GO:0031326	0.834	regulation of cellular biosynthetic process
GO:0019219	0.831	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.830	regulation of macromolecule biosynthetic process
GO:0051252	0.782	regulation of RNA metabolic process
GO:0006355	0.738	regulation of DNA-templated transcription
GO:0048522	0.692	positive regulation of cellular process
GO:0009790	0.682	embryo development
GO:0010604	0.677	positive regulation of macromolecule metabolic process
GO:0007389	0.650	pattern specification process
GO:0031325	0.650	positive regulation of cellular metabolic process
GO:0051173	0.649	positive regulation of nitrogen compound metabolic process
GO:0006357	0.649	regulation of transcription by RNA polymerase II
GO:0045935	0.606	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.576	cellular process
GO:0045893	0.506	positive regulation of DNA-templated transcription
GO:0045944	0.432	positive regulation of transcription by RNA polymerase II
GO:0048598	0.415	embryonic morphogenesis
GO:0003002	0.406	regionalization
GO:0001501	0.356	skeletal system development
GO:0009888	0.349	tissue development
GO:0048519	0.319	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.990	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]