StarFunc result for job id O43252

User Input

>input (624 residues)
MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
ENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
VINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTC
KNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGV
LNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPS
HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
PPEGFMAPKAWTVLTEYYKSLEKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1x6vA	0.630	0.697	0.000	564	0.897	0.993	1x6vA.pdb.gz	The Crystal Structure of Human PAPS Synthetase 1 Reveals Asymmetry in Substrate Binding
2	PDB:1xjqB	0.942	0.996	0.000	590	0.942	0.997	1xjqB.pdb.gz	The crystal structure of human PAPS synthetase 1 reveals asymmetry in substrate binding
3	AFDB:B2RYI8	0.985	0.985	0.000	624	0.981	0.981	B2RYI8.pdb.gz	B2RYI8_RAT Papss1 protein OS=Rattus norvegicus OX=10116 GN=Papss1 PE=2 SV=1
4	AFDB:O88428	0.635	0.638	0.000	621	0.755	0.758	O88428.pdb.gz	PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus OX=10090 GN=Papss2 PE=1 SV=2
5	AFDB:Q27128	0.697	0.711	6.445E-100	610	0.684	0.700	Q27128.pdb.gz	PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo OX=6431 PE=1 SV=1
6	AFDB:Q8IQV1	0.696	0.667	1.141E-93	657	0.619	0.588	Q8IQV1.pdb.gz	Q8IQV1_DROME PAPS synthetase, isoform D OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
7	AFDB:Q22501	0.635	0.609	1.706E-90	652	0.579	0.554	Q22501.pdb.gz
8	AFDB:Q43870	0.623	0.815	6.024E-62	476	0.378	0.496	Q43870.pdb.gz	APS2_ARATH ATP sulfurylase 2 OS=Arabidopsis thaliana OX=3702 GN=APS2 PE=1 SV=1
9	AFDB:Q9S7D8	0.620	0.823	6.771E-62	469	0.367	0.488	Q9S7D8.pdb.gz	APS4_ARATH ATP sulfurylase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS4 PE=1 SV=1
10	AFDB:Q9SDP4	0.614	0.829	1.020E-61	461	0.380	0.514	Q9SDP4.pdb.gz	Q9SDP4_ALLCE sulfate adenylyltransferase OS=Allium cepa OX=4679 PE=1 SV=1
11	AFDB:O23324	0.621	0.832	1.502E-60	465	0.365	0.490	O23324.pdb.gz	APS3_ARATH ATP-sulfurylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS3 PE=1 SV=1
12	AFDB:Q9LIK9	0.618	0.831	7.726E-60	463	0.377	0.508	Q9LIK9.pdb.gz	APS1_ARATH ATP sulfurylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS1 PE=1 SV=1
13	PDB:1j70A	0.543	0.656	1.025E-30	512	0.162	0.197	1j70A.pdb.gz	Structural and functional analysis of a truncated form of Saccharomyces cerevisiae ATP sulfurylase: C-terminal domain essential for oligomer formation but not for activity.
14	PDB:1m7gC	0.283	0.824	1.396E-20	209	0.176	0.526	1m7gC.pdb.gz	Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
15	PDB:1d6jB	0.266	0.878	8.622E-15	182	0.147	0.505	1d6jB.pdb.gz
16	PDB:1ko5A	0.201	0.649	3.125E-6	172	0.045	0.163	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
17	PDB:2axnA	0.182	0.246	1.806E-5	451	0.051	0.071	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
18	PDB:1bifA	0.177	0.249	7.352E-5	432	0.050	0.072	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
19	PDB:1e2fA	0.180	0.465	7.794E-5	210	0.046	0.138	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
20	PDB:2wwfC	0.186	0.475	1.107E-4	212	0.043	0.127	2wwfC.pdb.gz	Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RYI8	0.0	1291	624	0.981	0.981	B2RYI8_RAT Papss1 protein OS=Rattus norvegicus OX=10116 GN=Papss1 PE=2 SV=1
2	B5DFH4	0.0	1025	614	0.755	0.767	B5DFH4_RAT 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Rattus norvegicus OX=10116 GN=Papss2 PE=1 SV=1
3	O43252	0.0	1309	624	1.000	1.000	PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2
4	O88428	0.0	1022	621	0.756	0.760	PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus OX=10090 GN=Papss2 PE=1 SV=2
5	O95340	0.0	1030	614	0.755	0.767	PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2
6	Q27128	0.0	936	610	0.684	0.700	PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo OX=6431 PE=1 SV=1
7	Q60967	0.0	1298	624	0.987	0.987	PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus OX=10090 GN=Papss1 PE=1 SV=1
8	Q7KUT8	0.0	808	630	0.628	0.622	Q7KUT8_DROME PAPS synthetase, isoform E OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
9	Q8IQV1	0.0	808	657	0.628	0.597	Q8IQV1_DROME PAPS synthetase, isoform D OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
10	Q961A8	0.0	811	629	0.631	0.626	Q961A8_DROME LD25351p OS=Drosophila melanogaster OX=7227 GN=Papss PE=1 SV=1
11	Q9VW48	0.0	801	629	0.627	0.622	Q9VW48_DROME Bifunctional ATP sulfurylase/APS kinase OS=Drosophila melanogaster OX=7227 GN=Papss PE=2 SV=3
12	Q43870	7.37e-171	496	476	0.370	0.485	APS2_ARATH ATP sulfurylase 2 OS=Arabidopsis thaliana OX=3702 GN=APS2 PE=1 SV=1
13	Q9LIK9	3.76e-169	492	463	0.378	0.510	APS1_ARATH ATP sulfurylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS1 PE=1 SV=1
14	Q9S7D8	3.10e-168	489	469	0.369	0.490	APS4_ARATH ATP sulfurylase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS4 PE=1 SV=1
15	Q9SDP4	4.88e-167	486	461	0.370	0.501	Q9SDP4_ALLCE sulfate adenylyltransferase OS=Allium cepa OX=4679 PE=1 SV=1
16	O23324	1.93e-165	482	465	0.365	0.490	APS3_ARATH ATP-sulfurylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APS3 PE=1 SV=1
17	Q9UIR2	1.20e-158	457	265	0.338	0.796	Q9UIR2_HUMAN ATP sulfurylase/APS kinase isoform SK2 (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
18	Q9P7G9	1.99e-70	228	202	0.170	0.525	KAPS_SCHPO Adenylyl-sulfate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=met14 PE=3 SV=1
19	Q02196	3.81e-66	217	202	0.165	0.510	KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET14 PE=1 SV=1
20	Q12657	1.21e-65	216	211	0.176	0.521	KAPS_PENCH Adenylyl-sulfate kinase OS=Penicillium chrysogenum OX=5076 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	1.4e+02	13.2	6-phosphofructo-2-kinase
2	PF13207 AAA_17	6e+02	12.3	AAA domain
3	PF13238 AAA_18	1.2	21.1	AAA domain
4	PF13521 AAA_28	3.2e+02	12.9	AAA domain
5	PF13671 AAA_33	0.00033	32.3	AAA domain
6	PF01583 APS_kinase	3.2e-72	253.1	Adenylylsulphate kinase
7	PF01747 ATP-sulfurylase	6.2e-68	240.0	ATP-sulfurylase
8	PF08433 KTI12	1.7e+02	13.1	Chromatin associated protein KTI12
9	PF01293 PEPCK_ATP	1.5e+02	12.5	Phosphoenolpyruvate carboxykinase
10	PF00485 PRK	4.8e+02	11.9	Phosphoribulokinase / Uridine kinase family
11	PF14306 PUA_2	1.9e-46	169.1	PUA-like domain
12	PF03193 RsgA_GTPase	4.2e+02	12.2	RsgA GTPase
13	PF02223 Thymidylate_kin	1.1e+02	14.0	Thymidylate kinase
14	PF06414 Zeta_toxin	4.9e+02	11.5	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015796

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014725	0.995	3'-phosphoadenosine 5'-phosphosulfate synthase 2
2	61853.ENSNLEP00000021319	0.991	Sulfite oxidase
3	61853.ENSNLEP00000016969	0.934	3'(2'), 5'-bisphosphate nucleotidase 1
4	61853.ENSNLEP00000001564	0.924	Inositol monophosphatase domain containing 1
5	61853.ENSNLEP00000014069	0.886	FAD synthase
6	61853.ENSNLEP00000024256	0.738	Exportin 7
7	61853.ENSNLEP00000024421	0.658	Exportin 1
8	61853.ENSNLEP00000011545	0.652	Fibrinogen-like 2
9	61853.ENSNLEP00000006954	0.639	Zinc finger protein 639
10	61853.ENSNLEP00000000821	0.632	Protein prenyltransferase alpha subunit repeat containing 1
11	61853.ENSNLEP00000012273	0.629	Elongation factor 1-alpha
12	61853.ENSNLEP00000003548	0.623	S-formylglutathione hydrolase
13	61853.ENSNLEP00000016910	0.591	Thiosulfate sulfurtransferase (rhodanese)-like domain containing 1
14	61853.ENSNLEP00000005151	0.590	Elongation factor 1-alpha
15	61853.ENSNLEP00000010932	0.587	Janus kinase 2
16	61853.ENSNLEP00000005755	0.582	Raf-1 proto-oncogene, serine/threonine kinase
17	61853.ENSNLEP00000016091	0.580	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
18	61853.ENSNLEP00000004071	0.579	A-Raf proto-oncogene, serine/threonine kinase
19	61853.ENSNLEP00000009407	0.578	Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate
20	61853.ENSNLEP00000013469	0.572	Elongation factor Tu

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004781	1.000	sulfate adenylyltransferase (ATP) activity
GO:0016773	0.995	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.994	kinase activity
GO:0005515	0.969	protein binding
GO:0042802	0.950	identical protein binding
GO:0004020	0.938	adenylylsulfate kinase activity
GO:0042803	0.388	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.980	organic substance metabolic process
GO:0006790	0.979	sulfur compound metabolic process
GO:0044238	0.978	primary metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:1901564	0.973	organonitrogen compound metabolic process
GO:0034030	0.957	ribonucleoside bisphosphate biosynthetic process
GO:0043436	0.937	oxoacid metabolic process
GO:0034032	0.925	purine nucleoside bisphosphate metabolic process
GO:0034033	0.900	purine nucleoside bisphosphate biosynthetic process
GO:0009150	0.855	purine ribonucleotide metabolic process
GO:0044272	0.853	sulfur compound biosynthetic process
GO:0009152	0.824	purine ribonucleotide biosynthetic process
GO:0065007	0.593	biological regulation
GO:0032502	0.300	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.979	cytosol
GO:0032991	0.682	protein-containing complex
GO:0016020	0.369	membrane
GO:0043231	0.341	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18133	1.000	ATP + H(+) + sulfate = adenosine 5'-phosphosulfate + diphosphate
EC:2.7.7.4	1.000	sulfate adenylyltransferase.
EC:2.7.1.-	0.995	Phosphotransferases with an alcohol group as acceptor.
RHEA:24152	0.938	adenosine 5'-phosphosulfate + ATP = 3'-phosphoadenylyl sulfate + ADP + H(+)
EC:2.7.1.25	0.938	adenylyl-sulfate kinase.

[back to server]