StarFunc result for job id O43255

User Input

>input (324 residues)
MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGG
GGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTP
SIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGS
LEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYE
GHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFD
TAIAHLFADNGNLGINVTISTCCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06986	0.882	0.880	2.207E-64	325	0.981	0.978	Q06986.pdb.gz	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
2	AFDB:P61092	0.763	0.874	1.816E-50	282	0.670	0.770	P61092.pdb.gz	SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus OX=10090 GN=Siah1a PE=1 SV=1
3	AFDB:P21461	0.766	0.790	2.755E-49	314	0.654	0.675	P21461.pdb.gz	SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster OX=7227 GN=sina PE=1 SV=2
4	AFDB:Q965X6	0.727	0.570	1.083E-45	419	0.599	0.463	Q965X6.pdb.gz	SIAH1_CAEEL E3 ubiquitin-protein ligase siah-1 OS=Caenorhabditis elegans OX=6239 GN=siah-1 PE=1 SV=3
5	AFDB:Q8T3Y0	0.689	0.640	1.677E-37	351	0.410	0.379	Q8T3Y0.pdb.gz	SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster OX=7227 GN=sinah PE=1 SV=2
6	AFDB:Q9M2P4	0.683	0.715	1.623E-28	308	0.281	0.295	Q9M2P4.pdb.gz	SINA2_ARATH E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana OX=3702 GN=SINAT2 PE=1 SV=1
7	AFDB:Q8S3N1	0.705	0.737	4.990E-28	309	0.272	0.285	Q8S3N1.pdb.gz	SINA5_ARATH E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana OX=3702 GN=SINAT5 PE=1 SV=2
8	AFDB:Q10L91	0.700	0.749	1.446E-27	301	0.269	0.289	Q10L91.pdb.gz	DIS1_ORYSJ E3 ubiquitin-protein ligase DIS1 OS=Oryza sativa subsp. japonica OX=39947 GN=DIS1 PE=1 SV=1
9	AFDB:Q84JL3	0.667	0.663	1.832E-27	326	0.287	0.285	Q84JL3.pdb.gz	SINA3_ARATH E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana OX=3702 GN=SINAT3 PE=1 SV=1
10	AFDB:Q9STN8	0.684	0.679	3.309E-27	327	0.296	0.294	Q9STN8.pdb.gz	SINA4_ARATH E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana OX=3702 GN=SINAT4 PE=1 SV=1
11	PDB:5dkaA	0.228	0.677	3.113E-3	96	0.059	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:7jzvA	0.183	0.229	2.465E-2	253	0.086	0.111	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
13	PDB:5gm6a	0.151	0.373	1.018E-1	123	0.034	0.089	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:6xwuA	0.082	0.146	1.081E-1	138	0.028	0.065	6xwuA.pdb.gz
15	PDB:6xwvD	0.077	0.151	1.634E-1	123	0.025	0.065	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
16	PDB:6o6wA	0.108	0.183	2.070E-1	147	0.049	0.109	6o6wA.pdb.gz
17	PDB:4j1xC	0.085	0.122	2.330E-1	195	0.022	0.036	4j1xC.pdb.gz	Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
18	PDB:4akrB	0.110	0.137	3.132E-1	245	0.080	0.106	4akrB.pdb.gz
19	PDB:3lx2A	0.084	0.102	3.525E-1	247	0.056	0.073	3lx2A.pdb.gz
20	PDB:5vqfB	0.107	0.108	3.525E-1	320	0.052	0.053	5vqfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43255	0.0	670	324	1.000	1.000	SIAH2_HUMAN E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens OX=9606 GN=SIAH2 PE=1 SV=1
2	Q06986	0.0	652	325	0.981	0.978	SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus OX=10090 GN=Siah2 PE=1 SV=2
3	Q8R4T2	0.0	655	325	0.985	0.982	SIAH2_RAT E3 ubiquitin-protein ligase SIAH2 OS=Rattus norvegicus OX=10116 GN=Siah2 PE=1 SV=2
4	P61092	1.60e-164	461	282	0.685	0.787	SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus OX=10090 GN=Siah1a PE=1 SV=1
5	Q920M9	1.60e-164	461	282	0.685	0.787	SIAH1_RAT E3 ubiquitin-protein ligase SIAH1 OS=Rattus norvegicus OX=10116 GN=Siah1 PE=1 SV=2
6	Q8IUQ4	4.37e-164	460	282	0.682	0.784	SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens OX=9606 GN=SIAH1 PE=1 SV=2
7	Q06985	6.61e-163	457	282	0.654	0.752	SIA1B_MOUSE E3 ubiquitin-protein ligase SIAH1B OS=Mus musculus OX=10090 GN=Siah1b PE=2 SV=2
8	P21461	6.91e-154	435	314	0.645	0.666	SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster OX=7227 GN=sina PE=1 SV=2
9	Q965X6	1.03e-135	393	419	0.559	0.432	SIAH1_CAEEL E3 ubiquitin-protein ligase siah-1 OS=Caenorhabditis elegans OX=6239 GN=siah-1 PE=1 SV=3
10	Q8T3Y0	6.36e-89	271	351	0.417	0.385	SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster OX=7227 GN=sinah PE=1 SV=2
11	Q8IW03	2.94e-59	193	269	0.272	0.327	SIAH3_HUMAN Seven in absentia homolog 3 OS=Homo sapiens OX=9606 GN=SIAH3 PE=1 SV=3
12	Q9STN8	8.63e-41	147	327	0.275	0.272	SINA4_ARATH E3 ubiquitin-protein ligase SINAT4 OS=Arabidopsis thaliana OX=3702 GN=SINAT4 PE=1 SV=1
13	Q8S3N1	1.48e-40	145	309	0.281	0.294	SINA5_ARATH E3 ubiquitin-protein ligase SINAT5 OS=Arabidopsis thaliana OX=3702 GN=SINAT5 PE=1 SV=2
14	Q84JL3	2.93e-39	142	326	0.284	0.282	SINA3_ARATH E3 ubiquitin-protein ligase SINAT3 OS=Arabidopsis thaliana OX=3702 GN=SINAT3 PE=1 SV=1
15	Q10L91	1.50e-38	140	301	0.302	0.326	DIS1_ORYSJ E3 ubiquitin-protein ligase DIS1 OS=Oryza sativa subsp. japonica OX=39947 GN=DIS1 PE=1 SV=1
16	P93748	3.41e-38	139	305	0.296	0.315	SINA1_ARATH Putative E3 ubiquitin-protein ligase SINAT1 OS=Arabidopsis thaliana OX=3702 GN=SINAT1 PE=1 SV=1
17	Q9M2P4	1.30e-37	138	308	0.265	0.279	SINA2_ARATH E3 ubiquitin-protein ligase SINAT2 OS=Arabidopsis thaliana OX=3702 GN=SINAT2 PE=1 SV=1
18	Q9FKD7	3.52e-16	79.7	286	0.148	0.168	SINL7_ARATH E3 ubiquitin-protein ligase SINA-like 7 OS=Arabidopsis thaliana OX=3702 GN=At5g37890 PE=2 SV=1
19	Q9C9M0	1.77e-13	72.4	329	0.136	0.134	SINL4_ARATH E3 ubiquitin-protein ligase SINA-like 4 OS=Arabidopsis thaliana OX=3702 GN=At1g66650 PE=2 SV=1
20	Q93WE4	4.68e-13	69.3	216	0.157	0.236	SINA6_ARATH Probable inactive E3 ubiquitin-protein ligase SINAT6 OS=Arabidopsis thaliana OX=3702 GN=SINAT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03145 Sina	2.4e-80	280.8	Seven in absentia protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004055

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018657	0.938	Calcyclin binding protein
2	61853.ENSNLEP00000017444	0.838	Alpha-synuclein
3	61853.ENSNLEP00000000758	0.789	E3 ubiquitin-protein ligase
4	61853.ENSNLEP00000006991	0.771	Catenin beta 1
5	61853.ENSNLEP00000003960	0.727	Egl-9 family hypoxia-inducible factor 3
6	61853.ENSNLEP00000009823	0.716	Axin 1
7	61853.ENSNLEP00000018040	0.711	Axin 2
8	61853.ENSNLEP00000007645	0.707	Ubiquitin-conjugating enzyme E2E 3
9	61853.ENSNLEP00000001521	0.694	Uncharacterized protein
10	61853.ENSNLEP00000007105	0.688	Ubiquitinyl hydrolase 1
11	61853.ENSNLEP00000021039	0.658	Uncharacterized protein
12	61853.ENSNLEP00000002376	0.639	Large tumor suppressor kinase 2
13	61853.ENSNLEP00000017988	0.639	Nuclear receptor corepressor 1
14	61853.ENSNLEP00000020473	0.626	Anaphase promoting complex subunit 4
15	61853.ENSNLEP00000024418	0.626	Egl-9 family hypoxia-inducible factor 2
16	61853.ENSNLEP00000005055	0.624	Proteasome (prosome, macropain) 26S subunit, ATPase, 5
17	61853.ENSNLEP00000024353	0.624	APC, WNT signaling pathway regulator
18	61853.ENSNLEP00000008285	0.618	Ubiquitin specific peptidase 19
19	61853.ENSNLEP00000001603	0.599	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
20	61853.ENSNLEP00000022021	0.596	Ubiquitin-conjugating enzyme E2D 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	0.997	ubiquitin protein ligase activity
GO:0042802	0.543	identical protein binding
GO:0019899	0.370	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0019538	0.995	protein metabolic process
GO:0006508	0.981	proteolysis
GO:0009057	0.979	macromolecule catabolic process
GO:0050794	0.972	regulation of cellular process
GO:0044237	0.967	cellular metabolic process
GO:0019222	0.959	regulation of metabolic process
GO:0051603	0.952	proteolysis involved in protein catabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0043632	0.938	modification-dependent macromolecule catabolic process
GO:0006511	0.931	ubiquitin-dependent protein catabolic process
GO:0051246	0.839	regulation of protein metabolic process
GO:0050896	0.814	response to stimulus
GO:0048518	0.698	positive regulation of biological process
GO:0051716	0.498	cellular response to stimulus
GO:0048583	0.482	regulation of response to stimulus
GO:0031323	0.478	regulation of cellular metabolic process
GO:0048523	0.468	negative regulation of cellular process
GO:0009966	0.468	regulation of signal transduction
GO:0048522	0.457	positive regulation of cellular process
GO:0031399	0.446	regulation of protein modification process
GO:0007154	0.443	cell communication
GO:0023052	0.440	signaling
GO:0007165	0.434	signal transduction
GO:0009893	0.433	positive regulation of metabolic process
GO:0042752	0.432	regulation of circadian rhythm
GO:0036211	0.388	protein modification process
GO:0051173	0.355	positive regulation of nitrogen compound metabolic process
GO:0010604	0.355	positive regulation of macromolecule metabolic process
GO:0071840	0.350	cellular component organization or biogenesis
GO:0010468	0.338	regulation of gene expression
GO:1903320	0.318	regulation of protein modification by small protein conjugation or removal
GO:0016043	0.317	cellular component organization
GO:0009892	0.313	negative regulation of metabolic process
GO:0051247	0.305	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0012505	0.981	endomembrane system
GO:0032991	0.960	protein-containing complex
GO:0031982	0.901	vesicle
GO:1902494	0.478	catalytic complex
GO:0016020	0.373	membrane
GO:0140535	0.364	intracellular protein-containing complex
GO:0071944	0.327	cell periphery
GO:1990234	0.321	transferase complex
GO:0005886	0.316	plasma membrane
GO:0000151	0.306	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]