StarFunc result for job id O43257

User Input

>input (154 residues)
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDD
DADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVC
GFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43257	1.000	1.000	4.347E-29	154	1.000	1.000	O43257.pdb.gz	ZNHI1_HUMAN Zinc finger HIT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT1 PE=1 SV=1
2	AFDB:Q9VMV7	0.649	0.659	1.687E-14	151	0.532	0.543	Q9VMV7.pdb.gz	Q9VMV7_DROME RE52596p2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31917 PE=2 SV=2
3	AFDB:Q9FHW2	0.294	0.273	5.575E-9	171	0.364	0.327	Q9FHW2.pdb.gz	SWC6_ARATH SWR1 complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=SWC6 PE=1 SV=1
4	AFDB:O59669	0.524	0.571	1.362E-8	139	0.312	0.345	O59669.pdb.gz	VPS71_SCHPO SWR1 complex subunit vps71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps71 PE=1 SV=2
5	AFDB:Q385E0	0.346	0.212	1.783E-4	257	0.247	0.148	Q385E0.pdb.gz	Q385E0_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4160 PE=4 SV=1
6	PDB:6gejS	0.325	0.255	2.507E-3	208	0.201	0.149	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
7	AFDB:Q8RWS0	0.282	0.345	3.420E-3	124	0.130	0.161	Q8RWS0.pdb.gz	EEN_ARATH Protein EIN6 ENHANCER OS=Arabidopsis thaliana OX=3702 GN=EEN PE=1 SV=1
8	AFDB:P32617	0.259	0.243	1.262E-2	166	0.195	0.181	P32617.pdb.gz	IES6_YEAST Chromatin-remodeling complex subunit IES6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IES6 PE=1 SV=1
9	AFDB:Q384S0	0.222	0.065	1.550E-2	599	0.208	0.053	Q384S0.pdb.gz	Q384S0_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5350 PE=4 SV=1
10	AFDB:Q9UTE8	0.368	0.471	1.779E-2	117	0.123	0.162	Q9UTE8.pdb.gz	IES6_SCHPO Chromatin-remodeling complex subunit ies6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ies6 PE=3 SV=1
11	AFDB:Q6PI98	0.320	0.265	3.787E-2	192	0.130	0.104	Q6PI98.pdb.gz	IN80C_HUMAN INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1
12	PDB:6htsR	0.229	0.453	5.516E-2	72	0.110	0.236	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
13	PDB:5v3hA	0.200	0.076	1.133	438	0.065	0.023	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
14	PDB:5o85D	0.165	0.400	1.711	53	0.058	0.170	5o85D.pdb.gz	The intricate network between the p34 and p44 subunits is central to the activity of the transcription/DNA repair factor TFIIH.
15	PDB:4wa6D	0.190	0.075	3.902	415	0.045	0.017	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:5ex0A	0.196	0.079	4.180	429	0.078	0.028	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
17	PDB:7egb3	0.160	0.103	4.477	263	0.065	0.038	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:7oniR	0.165	0.271	5.136	86	0.058	0.105	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:2lgvA	0.171	0.232	6.312	100	0.065	0.100	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
20	PDB:1u5kA	0.086	0.058	7.756	242	0.052	0.033	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43257	1.01e-113	320	154	1.000	1.000	ZNHI1_HUMAN Zinc finger HIT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT1 PE=1 SV=1
2	Q8R331	4.68e-111	313	154	0.974	0.974	ZNHI1_MOUSE Zinc finger HIT domain-containing protein 1 OS=Mus musculus OX=10090 GN=Znhit1 PE=1 SV=1
3	Q9VMV7	2.15e-45	147	151	0.513	0.523	Q9VMV7_DROME RE52596p2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31917 PE=2 SV=2
4	Q9FHW2	9.07e-21	85.1	171	0.357	0.322	SWC6_ARATH SWR1 complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=SWC6 PE=1 SV=1
5	O59669	6.87e-16	71.6	139	0.312	0.345	VPS71_SCHPO SWR1 complex subunit vps71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps71 PE=1 SV=2
6	Q385E0	1.43e-05	45.4	257	0.136	0.082	Q385E0_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4160 PE=4 SV=1
7	Q03433	9.63e-05	43.1	280	0.110	0.061	VPS71_YEAST Vacuolar protein sorting-associated protein 71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS71 PE=1 SV=1
8	Q84RQ9	0.058	35.4	496	0.117	0.036	ARI12_ARATH Probable E3 ubiquitin-protein ligase ARI12 OS=Arabidopsis thaliana OX=3702 GN=ARI12 PE=2 SV=2
9	O15062	0.068	35.0	677	0.078	0.018	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
10	Q384S0	0.078	35.0	599	0.084	0.022	Q384S0_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5350 PE=4 SV=1
11	Q7ZUF9	0.36	32.3	151	0.091	0.093	Q7ZUF9_DANRE Zgc:56688 OS=Danio rerio OX=7955 GN=zgc:56688 PE=2 SV=1
12	Q8T3N7	0.57	32.3	892	0.071	0.012	Q8T3N7_DROME GM03859p OS=Drosophila melanogaster OX=7227 GN=Kots PE=2 SV=1
13	Q9VFP5	0.57	32.3	892	0.071	0.012	Q9VFP5_DROME RE70955p OS=Drosophila melanogaster OX=7227 GN=Kots PE=2 SV=1
14	P46973	0.78	31.6	164	0.071	0.067	HIT1_YEAST Protein HIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HIT1 PE=1 SV=1
15	Q9UHR6	0.79	32.0	403	0.097	0.037	ZNHI2_HUMAN Zinc finger HIT domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZNHIT2 PE=1 SV=1
16	Q9VZK2	1.2	31.6	653	0.097	0.023	Q9VZK2_DROME FI01106p OS=Drosophila melanogaster OX=7227 GN=scrt PE=2 SV=1
17	Q7KMM2	1.3	31.2	567	0.097	0.026	Q7KMM2_DROME Scratch OS=Drosophila melanogaster OX=7227 GN=scrt PE=2 SV=1
18	Q24140	1.4	31.2	664	0.097	0.023	Q24140_DROME Neuron specific zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=scrt PE=2 SV=1
19	A0A0R4IUM7	1.8	31.2	1955	0.097	0.008	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
20	Q20JQ9	1.8	31.2	1955	0.097	0.008	Q20JQ9_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1Laa PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04438 zf-HIT	1.2e-06	39.5	HIT zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008590984.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008580551.1	0.981	ruvB-like 1
2	482537.XP_008582507.1	0.980	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008567539.1	0.978	ruvB-like 2
4	482537.XP_008568601.1	0.967	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 15 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008563446.1	0.941	Actin-related protein 6-like
6	482537.XP_008575443.1	0.941	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008587004.1	0.941	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
8	482537.XP_008573452.1	0.927	YEATS domain-containing protein 4
9	482537.XP_008592286.1	0.914	Helicase SRCAP isoform X1
10	482537.XP_008567095.1	0.880	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
11	482537.XP_008572836.1	0.880	E1A-binding protein p400 isoform X1
12	482537.XP_008570000.1	0.879	Histone H2A.V
13	482537.XP_008583237.1	0.879	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 mRNAs, 38 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008566331.1	0.872	Actin-like protein 6A
15	482537.XP_008578936.1	0.872	Actin-like protein 6B isoform X1
16	482537.XP_008566082.1	0.868	Uncharacterized protein LOC103586565
17	482537.XP_008585934.1	0.848	DNA helicase INO80
18	482537.XP_008584412.1	0.837	Actin-related protein 8 isoform X1
19	482537.XP_008576398.1	0.810	INO80 complex subunit C-like
20	482537.XP_008563538.1	0.791	YEATS domain-containing protein 2-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.995	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.976	positive regulation of cellular process
GO:0019222	0.871	regulation of metabolic process
GO:0080090	0.864	regulation of primary metabolic process
GO:0051171	0.864	regulation of nitrogen compound metabolic process
GO:0060255	0.860	regulation of macromolecule metabolic process
GO:0031323	0.760	regulation of cellular metabolic process
GO:0071840	0.748	cellular component organization or biogenesis
GO:0016043	0.720	cellular component organization
GO:0019219	0.714	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.681	regulation of gene expression
GO:0006338	0.654	chromatin remodeling
GO:0048583	0.635	regulation of response to stimulus
GO:0010604	0.632	positive regulation of macromolecule metabolic process
GO:0051252	0.600	regulation of RNA metabolic process
GO:0031326	0.498	regulation of cellular biosynthetic process
GO:0048584	0.493	positive regulation of response to stimulus
GO:0006355	0.486	regulation of DNA-templated transcription
GO:0080134	0.400	regulation of response to stress
GO:0051173	0.393	positive regulation of nitrogen compound metabolic process
GO:0048519	0.378	negative regulation of biological process
GO:2001020	0.378	regulation of response to DNA damage stimulus
GO:0051726	0.373	regulation of cell cycle
GO:0031325	0.371	positive regulation of cellular metabolic process
GO:0045935	0.344	positive regulation of nucleobase-containing compound metabolic process
GO:2001022	0.335	positive regulation of response to DNA damage stimulus
GO:0048523	0.318	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.343	intracellular non-membrane-bounded organelle
GO:0032991	0.319	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]