StarFunc result for job id O43278

User Input

>input (529 residues)
MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPG
FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
PDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVV
AILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43278	1.000	1.000	0.000	529	1.000	1.000	O43278.pdb.gz	SPIT1_HUMAN Kunitz-type protease inhibitor 1 OS=Homo sapiens OX=9606 GN=SPINT1 PE=1 SV=2
2	AFDB:Q4V8Q2	0.779	0.811	6.237E-84	507	0.741	0.773	Q4V8Q2.pdb.gz	Q4V8Q2_RAT Serine peptidase inhibitor, Kunitz type 1 OS=Rattus norvegicus OX=10116 GN=Spint1 PE=4 SV=1
3	AFDB:B3DKP8	0.654	0.689	8.684E-50	501	0.363	0.383	B3DKP8.pdb.gz
4	AFDB:A0A2R8QCE4	0.640	0.647	2.730E-48	523	0.340	0.344	A0A2R8QCE4.pdb.gz	A0A2R8QCE4_DANRE Serine peptidase inhibitor, Kunitz type 1 a OS=Danio rerio OX=7955 GN=cb376 PE=1 SV=1
5	AFDB:A0A2R8QMJ2	0.482	0.509	4.291E-46	498	0.338	0.359	A0A2R8QMJ2.pdb.gz
6	AFDB:Q86VZ4	0.170	0.179	2.301E-18	500	0.246	0.260	Q86VZ4.pdb.gz	LRP11_HUMAN Low-density lipoprotein receptor-related protein 11 OS=Homo sapiens OX=9606 GN=LRP11 PE=2 SV=2
7	AFDB:G3V8S0	0.132	0.245	2.020E-14	250	0.127	0.268	G3V8S0.pdb.gz	G3V8S0_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=2
8	AFDB:O43291	0.126	0.232	3.199E-14	252	0.132	0.278	O43291.pdb.gz	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
9	AFDB:Q9WU03	0.113	0.236	4.026E-14	252	0.119	0.250	Q9WU03.pdb.gz	SPIT2_MOUSE Kunitz-type protease inhibitor 2 OS=Mus musculus OX=10090 GN=Spint2 PE=1 SV=1
10	AFDB:O54819	0.127	0.205	1.587E-11	306	0.117	0.203	O54819.pdb.gz	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1
11	PDB:4bd9B	0.101	0.319	6.052E-9	165	0.106	0.339	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
12	PDB:3bybA	0.098	0.874	5.606E-4	58	0.043	0.397	3bybA.pdb.gz
13	PDB:5ngjA	0.112	0.130	2.102E-3	440	0.042	0.050	5ngjA.pdb.gz
14	PDB:2m01A	0.098	0.751	1.664E-2	59	0.043	0.390	2m01A.pdb.gz
15	PDB:6k15X	0.105	0.289	4.683E-2	147	0.032	0.116	6k15X.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:4ev0D	0.085	0.151	6.242E-2	214	0.032	0.079	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
17	PDB:3zmrA	0.110	0.121	7.002E-2	469	0.028	0.032	3zmrA.pdb.gz	A Discrete Genetic Locus Confers Xyloglucan Metabolism in Select Human Gut Bacteroidetes
18	PDB:1rowA	0.102	0.350	8.320E-2	107	0.023	0.112	1rowA.pdb.gz
19	PDB:5i25A	0.131	0.119	8.812E-2	596	0.059	0.052	5i25A.pdb.gz	A novel DFP tripeptide motif interacts with the coagulation factor XI apple 2 domain.
20	PDB:4avaA	0.076	0.099	1.478E-1	327	0.040	0.064	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43278	0.0	1099	529	1.000	1.000	SPIT1_HUMAN Kunitz-type protease inhibitor 1 OS=Homo sapiens OX=9606 GN=SPINT1 PE=1 SV=2
2	Q4V8Q2	0.0	832	507	0.741	0.773	Q4V8Q2_RAT Serine peptidase inhibitor, Kunitz type 1 OS=Rattus norvegicus OX=10116 GN=Spint1 PE=4 SV=1
3	Q9R097	0.0	858	507	0.773	0.807	SPIT1_MOUSE Kunitz-type protease inhibitor 1 OS=Mus musculus OX=10090 GN=Spint1 PE=1 SV=2
4	A0A2R8QCE4	1.01e-103	323	523	0.352	0.356	A0A2R8QCE4_DANRE Serine peptidase inhibitor, Kunitz type 1 a OS=Danio rerio OX=7955 GN=cb376 PE=1 SV=1
5	A9JR82	1.17e-102	319	499	0.365	0.387	A9JR82_DANRE Serine peptidase inhibitor, Kunitz type 1 b precursor OS=Danio rerio OX=7955 GN=spint1b PE=1 SV=1
6	Q7T363	1.80e-98	309	516	0.353	0.362	Q7T363_DANRE Serine peptidase inhibitor, Kunitz type 1 a precursor OS=Danio rerio OX=7955 GN=zgc:64075 PE=1 SV=1
7	O43291	1.08e-27	113	252	0.146	0.306	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
8	F6QKA3	5.80e-26	108	250	0.147	0.312	F6QKA3_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
9	G3V8S0	7.49e-26	108	258	0.149	0.306	G3V8S0_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=2
10	Q86VZ4	3.70e-23	105	500	0.140	0.148	LRP11_HUMAN Low-density lipoprotein receptor-related protein 11 OS=Homo sapiens OX=9606 GN=LRP11 PE=2 SV=2
11	Q8CB67	6.56e-22	100	483	0.140	0.153	LRP11_MOUSE Low-density lipoprotein receptor-related protein 11 OS=Mus musculus OX=10090 GN=Lrp11 PE=1 SV=1
12	Q9WU03	2.80e-21	95.5	252	0.121	0.254	SPIT2_MOUSE Kunitz-type protease inhibitor 2 OS=Mus musculus OX=10090 GN=Spint2 PE=1 SV=1
13	Q02445	6.96e-18	86.7	302	0.130	0.228	TFPI1_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi PE=2 SV=1
14	O54819	6.63e-17	84.0	306	0.121	0.209	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1
15	G3V7D5	1.33e-16	81.3	230	0.115	0.265	G3V7D5_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi2 PE=4 SV=1
16	Q8CF99	1.39e-16	81.3	230	0.115	0.265	Q8CF99_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi2 PE=2 SV=1
17	P84875	1.60e-16	79.3	165	0.110	0.352	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
18	P10646	2.23e-16	82.0	304	0.117	0.204	TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1
19	P48307	4.65e-16	79.7	235	0.127	0.285	TFPI2_HUMAN Tissue factor pathway inhibitor 2 OS=Homo sapiens OX=9606 GN=TFPI2 PE=1 SV=1
20	Q868Z9	1.19e-15	83.2	2898	0.123	0.022	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08107 Antimicrobial12	5.2e+02	11.8	Pleurocidin family
2	PF05961 Chordopox_A13L	2.2e+02	13.5	Chordopoxvirus A13L protein
3	PF00014 Kunitz_BPTI	2.1e-30	116.0	Kunitz/Bovine pancreatic trypsin inhibitor domain
4	PF00057 Ldl_recept_a	1.3e-05	36.6	Low-density lipoprotein receptor domain class A
5	PF07502 MANEC	5.4e-25	98.8	MANEC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342098

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278742	0.998	Suppressor of tumorigenicity 14 protein
2	9606.ENSP00000421801	0.997	Hepatocyte growth factor activator
3	9606.ENSP00000222390	0.963	Hepatocyte growth factor
4	9606.ENSP00000414287	0.938	Hepatocyte growth factor-like protein
5	9606.ENSP00000319730	0.903	Prostasin
6	9606.ENSP00000262626	0.787	Serine protease hepsin
7	9606.ENSP00000353475	0.766	Claudin-7
8	9606.ENSP00000434279	0.670	Transmembrane protease serine 13
9	9606.ENSP00000301420	0.663	Kallikrein-1
10	9606.ENSP00000353701	0.651	Dipeptidyl peptidase 3
11	9606.ENSP00000364028	0.649	Endothelin-converting enzyme 1
12	9606.ENSP00000454071	0.636	Low-density lipoprotein receptor
13	9606.ENSP00000381588	0.625	Transmembrane protease serine 2
14	9606.ENSP00000477949	0.623	Transmembrane protease serine 4
15	9606.ENSP00000354376	0.621	Ras-related protein Rab-25
16	9606.ENSP00000254286	0.605	Actin related protein 10 homolog
17	9606.ENSP00000307519	0.586	Transmembrane protease serine 11E
18	9606.ENSP00000261769	0.582	Cadherin-1
19	9606.ENSP00000326366	0.570	Presenilin-1
20	9606.ENSP00000465419	0.570	Tight junction protein ZO-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	0.999	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.968	anatomical structure development
GO:0009987	0.966	cellular process
GO:0050789	0.965	regulation of biological process
GO:0050794	0.901	regulation of cellular process
GO:0050896	0.879	response to stimulus
GO:0032501	0.610	multicellular organismal process
GO:0048518	0.518	positive regulation of biological process
GO:0048519	0.498	negative regulation of biological process
GO:0048522	0.470	positive regulation of cellular process
GO:0009888	0.458	tissue development
GO:0048523	0.454	negative regulation of cellular process
GO:0071840	0.438	cellular component organization or biogenesis
GO:0016043	0.407	cellular component organization
GO:0060429	0.383	epithelium development
GO:0051239	0.366	regulation of multicellular organismal process
GO:0009653	0.341	anatomical structure morphogenesis
GO:0007275	0.340	multicellular organism development
GO:0043062	0.306	extracellular structure organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.990	membrane-bounded organelle
GO:0005576	0.979	extracellular region
GO:0071944	0.955	cell periphery
GO:0031982	0.952	vesicle
GO:0005886	0.949	plasma membrane
GO:0070062	0.889	extracellular exosome
GO:0043231	0.767	intracellular membrane-bounded organelle
GO:0005737	0.706	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]