StarFunc result for job id O43283

User Input

>input (966 residues)
MANFQEHLSCSSSPHLPFSESKTFNGLQDELTAMGNHPSPKLLEDQQEKGMVRTELIESV
HSPVTTTVLTSVSEDSRDQFENSVLQLREHDESETAVSQGNSNTVDGESTSGTEDIKIQF
SRSGSGSGGFLEGLFGCLRPVWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQG
AVFLGKFRAEEVAIKKVREQNETDIKHLRKLKHPNIIAFKGVCTQAPCYCIIMEYCAHGQ
LYEVLRAGRKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGT
SKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSA
IIWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTLMHLDIASADVLATPQE
TYFKSQAEWREEVKKHFEKIKSEGTCIHRLDEELIRRRREELRHALDIREHYERKLERAN
NLYMELSAIMLQLEMREKELIKREQAVEKKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPH
KSGMQTKRPDLLRSEGIPTTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHS
DFAAILKNQPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQPPPAMSQSHHPRLNMHG
QDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLISTAMAADCWRSSEPDKGQAGP
WGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENE
FSGCRSESSLGTSHLGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCIS
SCQSYSTFSSENFSVSDGEEGNTSDHSNSPDELADKLEDRLAEKLDDLLSQTPEIPIDIS
SHSDGLSDKECAVRRVKTQMSLGKLCVEERGYENPMQFEESDCDSSDGECSDATVRTNKH
YSSATW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43283	0.999	0.999	0.000	966	1.000	1.000	O43283.pdb.gz	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
2	AFDB:Q1HKZ5	0.395	0.398	0.000	959	0.890	0.897	Q1HKZ5.pdb.gz	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
3	AFDB:Q60700	0.395	0.426	1.333E-70	888	0.495	0.538	Q60700.pdb.gz	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
4	AFDB:Q7T2V3	0.319	0.307	1.611E-30	1005	0.236	0.227	Q7T2V3.pdb.gz	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
5	AFDB:P80192	0.300	0.265	2.667E-30	1104	0.226	0.197	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
6	AFDB:Q5TCX8	0.287	0.269	7.313E-30	1036	0.228	0.212	Q5TCX8.pdb.gz	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
7	AFDB:Q95UN8	0.295	0.248	1.792E-29	1161	0.218	0.182	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
8	AFDB:A0A0G2JUN9	0.286	0.259	1.886E-28	1077	0.215	0.193	A0A0G2JUN9.pdb.gz	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
9	AFDB:F7BN18	0.248	0.213	1.369E-20	1128	0.149	0.128	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
10	AFDB:P42684	0.248	0.204	3.752E-20	1182	0.144	0.118	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
11	PDB:2h8hA	0.249	0.522	1.295E-19	445	0.085	0.184	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.240	0.515	9.202E-19	441	0.081	0.177	1k9aB.pdb.gz
13	PDB:4btfA	0.222	0.493	8.185E-18	413	0.079	0.184	4btfA.pdb.gz
14	PDB:7mfdA	0.236	0.535	1.083E-17	410	0.100	0.237	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
15	PDB:4fl2A	0.242	0.411	1.355E-17	555	0.082	0.142	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
16	PDB:4k2rA	0.234	0.400	2.808E-17	551	0.079	0.138	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:6lk5A	0.235	0.800	1.687E-16	265	0.078	0.283	6lk5A.pdb.gz
18	PDB:8bfsA	0.236	0.754	4.626E-16	274	0.073	0.259	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
19	PDB:6s73A	0.230	0.763	8.102E-16	269	0.061	0.219	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:8dksA	0.209	0.669	1.199E-15	283	0.078	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43283	0.0	2013	966	1.000	1.000	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
2	Q12852	0.0	791	859	0.494	0.555	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
3	Q1HKZ5	0.0	1729	959	0.890	0.897	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
4	Q60700	0.0	802	888	0.398	0.432	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
5	Q9VW24	3.12e-167	516	977	0.247	0.245	Q9VW24_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
6	D3DMF6	5.04e-167	515	950	0.247	0.252	D3DMF6_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
7	O01700	1.52e-114	376	928	0.194	0.202	DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans OX=6239 GN=dlk-1 PE=1 SV=4
8	D3ZG83	9.99e-76	270	940	0.155	0.160	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
9	Q66L42	2.70e-75	268	940	0.154	0.159	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
10	Q02779	1.34e-74	266	954	0.151	0.153	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
11	Q80XI6	1.75e-73	261	850	0.155	0.176	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
12	Q66HA1	1.77e-73	261	850	0.155	0.176	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
13	Q16584	2.65e-73	261	847	0.155	0.177	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
14	Q7T2V3	5.45e-73	263	1005	0.166	0.159	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
15	F1LRA7	4.70e-71	258	1100	0.145	0.127	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
16	A0A0G2JUN9	5.39e-71	258	1078	0.145	0.130	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
17	P80192	7.00e-71	258	1104	0.147	0.129	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
18	Q95UN8	3.64e-66	244	1161	0.146	0.121	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
19	Q5TCX8	3.42e-65	240	1036	0.148	0.138	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
20	D4Q8H0	1.30e-59	213	455	0.139	0.295	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	13	16.4	ABC1 atypical kinase-like domain
2	PF01636 APH	1.2e+02	13.9	Phosphotransferase enzyme family
3	PF00069 Pkinase	3.9e-56	201.9	Protein kinase domain
4	PF17667 Pkinase_fungal	11	16.3	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	2.4e-61	218.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381070	0.952	Dual specificity mitogen-activated protein kinase kinase 7
2	9606.ENSP00000241014	0.891	C-Jun-amino-terminal kinase-interacting protein 1
3	9606.ENSP00000444596	0.803	E3 ubiquitin-protein ligase MYCBP2
4	9606.ENSP00000330572	0.777	C-Jun-amino-terminal kinase-interacting protein 2
5	9606.ENSP00000284637	0.735	E3 ubiquitin-protein ligase SH3RF1
6	9606.ENSP00000406885	0.675	Transmembrane protein 41A
7	9606.ENSP00000228945	0.667	Rho GDP-dissociation inhibitor 2
8	9606.ENSP00000360266	0.629	Transcription factor AP-1
9	9606.ENSP00000383118	0.621	Cell division control protein 42 homolog
10	9606.ENSP00000310332	0.609	F-box/SPRY domain-containing protein 1
11	9606.ENSP00000341551	0.553	Mothers against decapentaplegic homolog 4
12	9606.ENSP00000355621	0.547	Tetratricopeptide repeat domain containing
13	9606.ENSP00000379182	0.525	mRNA export factor
14	9606.ENSP00000278200	0.504	Mitochondrial inner membrane protease subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004709	0.999	MAP kinase kinase kinase activity
GO:0019899	0.996	enzyme binding
GO:0042802	0.944	identical protein binding
GO:0046983	0.932	protein dimerization activity
GO:0042803	0.844	protein homodimerization activity
GO:0044877	0.721	protein-containing complex binding
GO:0098772	0.418	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008152	0.995	metabolic process
GO:0050789	0.995	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0036211	0.982	protein modification process
GO:0019222	0.981	regulation of metabolic process
GO:0016310	0.975	phosphorylation
GO:0007165	0.975	signal transduction
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0007254	0.952	JNK cascade
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0080090	0.935	regulation of primary metabolic process
GO:0044093	0.929	positive regulation of molecular function
GO:0006468	0.924	protein phosphorylation
GO:0031323	0.920	regulation of cellular metabolic process
GO:0048518	0.907	positive regulation of biological process
GO:0048522	0.772	positive regulation of cellular process
GO:0010468	0.707	regulation of gene expression
GO:0048583	0.662	regulation of response to stimulus
GO:0010604	0.510	positive regulation of macromolecule metabolic process
GO:0051173	0.487	positive regulation of nitrogen compound metabolic process
GO:0006355	0.486	regulation of DNA-templated transcription
GO:0071840	0.471	cellular component organization or biogenesis
GO:0009966	0.465	regulation of signal transduction
GO:0051246	0.462	regulation of protein metabolic process
GO:0031325	0.454	positive regulation of cellular metabolic process
GO:1902531	0.438	regulation of intracellular signal transduction
GO:0016043	0.424	cellular component organization
GO:0048519	0.355	negative regulation of biological process
GO:0042325	0.330	regulation of phosphorylation
GO:1902533	0.330	positive regulation of intracellular signal transduction
GO:0050790	0.328	regulation of catalytic activity
GO:0051247	0.312	positive regulation of protein metabolic process
GO:0031399	0.309	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005886	0.550	plasma membrane
GO:0005622	0.426	intracellular anatomical structure
GO:0005737	0.339	cytoplasm
GO:0043226	0.313	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.25	0.999	mitogen-activated protein kinase kinase kinase.

[back to server]