StarFunc result for job id O43286

User Input

>input (388 residues)
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTI
GAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPS
MKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVL
FRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPE
SDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGED
DDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN
YFANITYDALYKNITVNLTPELAQVNEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1S6M251	0.962	0.962	1.970E-80	388	0.966	0.966	A0A1S6M251.pdb.gz	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
2	AFDB:F1QGG1	0.904	0.920	1.265E-67	381	0.724	0.738	F1QGG1.pdb.gz
3	AFDB:O88419	0.929	0.944	1.463E-66	382	0.686	0.696	O88419.pdb.gz	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
4	AFDB:Q3YL68	0.904	0.919	7.177E-66	381	0.688	0.701	Q3YL68.pdb.gz	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
5	AFDB:O60909	0.668	0.696	2.384E-36	372	0.338	0.352	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
6	AFDB:P15535	0.665	0.647	3.238E-36	399	0.338	0.328	P15535.pdb.gz	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
7	AFDB:P15291	0.663	0.647	5.970E-36	398	0.322	0.314	P15291.pdb.gz	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
8	AFDB:P08037	0.665	0.642	6.346E-36	402	0.320	0.308	P08037.pdb.gz	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
9	AFDB:A0A384NY44	0.672	0.664	1.101E-35	393	0.327	0.323	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
10	AFDB:Q9GUM2	0.663	0.671	1.625E-34	383	0.322	0.326	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
11	PDB:4fixA	0.318	0.206	1.707E-5	629	0.085	0.052	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
12	PDB:4d0tA	0.317	0.256	6.170E-5	496	0.080	0.062	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
13	PDB:6pxuB	0.338	0.258	8.907E-5	532	0.085	0.062	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
14	PDB:6h0bB	0.323	0.249	1.286E-4	521	0.075	0.056	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
15	PDB:4d11C	0.317	0.286	3.219E-4	436	0.080	0.071	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
16	PDB:6iwqA	0.329	0.244	1.680E-3	546	0.113	0.081	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
17	PDB:5mlzA	0.155	0.169	1.785E-3	355	0.052	0.056	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
18	PDB:2d7iA	0.288	0.214	2.281E-3	536	0.075	0.054	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
19	PDB:4y63A	0.270	0.356	3.955E-3	282	0.106	0.145	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
20	PDB:4decA	0.311	0.404	4.205E-3	284	0.064	0.088	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1S6M251	0.0	791	388	0.966	0.966	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
2	O43286	0.0	813	388	1.000	1.000	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
3	O88419	0.0	584	382	0.691	0.702	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
4	Q3YL68	0.0	553	381	0.688	0.701	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
5	Q802Y5	0.0	596	381	0.727	0.740	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
6	Q9JMK0	0.0	723	388	0.876	0.876	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
7	Q9UBX8	0.0	570	382	0.704	0.715	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1
8	Q9WVK5	0.0	583	382	0.691	0.702	B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B4galt6 PE=1 SV=1
9	Q99PC2	3.95e-80	253	393	0.325	0.321	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
10	P15535	1.17e-78	249	399	0.338	0.328	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
11	P08037	5.66e-76	242	402	0.317	0.306	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
12	P15291	6.14e-76	242	398	0.322	0.314	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
13	Q9Z2Y2	2.06e-73	235	369	0.304	0.320	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
14	A0A384NY44	4.43e-73	234	393	0.304	0.300	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
15	O60512	4.43e-73	234	393	0.304	0.300	B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2
16	O60909	1.83e-71	230	372	0.299	0.312	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
17	Q9GUM2	4.32e-71	229	383	0.289	0.292	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
18	Q7KN92	2.86e-65	215	403	0.286	0.275	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
19	B2RAZ5	5.64e-63	207	344	0.281	0.317	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
20	O60513	5.64e-63	207	344	0.281	0.317	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02709 Glyco_transf_7C	8.3e-27	104.1	N-terminal domain of galactosyltransferase
2	PF13733 Glyco_transf_7N	3.2e-52	187.1	N-terminal region of glycosyl transferase group 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415454	0.945	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
2	9606.ENSP00000414350	0.912	Mucin-20
3	9606.ENSP00000266719	0.909	Keratocan
4	9606.ENSP00000381008	0.905	Mucin-16
5	9606.ENSP00000407422	0.905	Mucin-7
6	9606.ENSP00000484824	0.905	Mucin-1
7	9606.ENSP00000387356	0.904	Aggrecan core protein
8	9606.ENSP00000406861	0.904	Mucin-6
9	9606.ENSP00000436812	0.904	Mucin-5B
10	9606.ENSP00000485028	0.904	Mucin-13
11	9606.ENSP00000266718	0.902	Lumican
12	9606.ENSP00000416753	0.902	Mucin-15
13	9606.ENSP00000417498	0.902	Mucin-4
14	9606.ENSP00000485659	0.902	Mucin-5AC
15	9606.ENSP00000441929	0.901	Mucin-12
16	9606.ENSP00000262551	0.900	Mimecan
17	9606.ENSP00000302716	0.900	Mucin-17
18	9606.ENSP00000311364	0.900	Mucin-like protein 1
19	9606.ENSP00000343924	0.900	Prolargin
20	9606.ENSP00000347041	0.900	Fibromodulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0005515	0.969	protein binding
GO:0008489	0.889	UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity
GO:0140096	0.325	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0070085	0.987	glycosylation
GO:0006807	0.986	nitrogen compound metabolic process
GO:1901564	0.984	organonitrogen compound metabolic process
GO:1901135	0.983	carbohydrate derivative metabolic process
GO:0006486	0.943	protein glycosylation
GO:0006665	0.725	sphingolipid metabolic process
GO:0006664	0.567	glycolipid metabolic process
GO:0006687	0.553	glycosphingolipid metabolic process
GO:0046467	0.414	membrane lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.997	membrane
GO:0031090	0.970	organelle membrane
GO:0000139	0.922	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]