StarFunc result for job id O43290

User Input

>input (800 residues)
MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERG
GERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSI
EETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLL
NQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEE
FGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERA
EKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGL
RERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGG
APPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWE
EDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDG
EENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVAR
VKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKL
TPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQK
TPYIVLSGSGKSMNANTITK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43290	1.000	1.000	0.000	800	1.000	1.000	O43290.pdb.gz	SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1
2	PDB:6ahd9	0.095	0.419	2.270E-16	165	0.206	1.000	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
3	PDB:6qw6S	0.081	0.429	2.474E-11	126	0.156	0.992	6qw6S.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
4	PDB:5o9zP	0.048	0.322	4.116E-5	91	0.096	0.846	5o9zP.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
5	AFDB:Q38AZ5	0.057	0.063	1.351E-2	715	0.142	0.159	Q38AZ5.pdb.gz	Q38AZ5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0760 PE=4 SV=1
6	AFDB:O95447	0.082	0.094	1.976E-2	670	0.113	0.134	O95447.pdb.gz	LCA5L_HUMAN Lebercilin-like protein OS=Homo sapiens OX=9606 GN=LCA5L PE=1 SV=1
7	AFDB:O60284	0.049	0.040	2.390E-2	1047	0.114	0.087	O60284.pdb.gz	ST18_HUMAN Suppression of tumorigenicity 18 protein OS=Homo sapiens OX=9606 GN=ST18 PE=1 SV=1
8	AFDB:G5ECC0	0.058	0.074	5.805E-2	587	0.066	0.090	G5ECC0.pdb.gz	G5ECC0_CAEEL Kinesin like protein OS=Caenorhabditis elegans OX=6239 GN=klp-16 PE=1 SV=1
9	AFDB:Q61595	0.066	0.043	5.805E-2	1327	0.100	0.060	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
10	AFDB:Q12151	0.064	0.059	6.184E-2	913	0.094	0.082	Q12151.pdb.gz	UPC2_YEAST Sterol uptake control protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UPC2 PE=1 SV=1
11	AFDB:B3RH40	0.061	0.043	7.020E-2	1255	0.126	0.080	B3RH40.pdb.gz	B3RH40_MEDTR Myosin heavy chain-like protein, putative OS=Medicago truncatula OX=3880 GN=25484843 PE=4 SV=1
12	AFDB:Q9W3D1	0.048	0.036	7.480E-2	1183	0.124	0.084	Q9W3D1.pdb.gz	Q9W3D1_DROME Chromatin assembly factor 1, p180 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-180 PE=1 SV=1
13	AFDB:A0A2R8QLT0	0.058	0.057	9.638E-2	816	0.140	0.137	A0A2R8QLT0.pdb.gz
14	PDB:5nrlE	0.058	0.302	5.541E-1	124	0.031	0.202	5nrlE.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:7ae1M	0.039	0.065	1.434	400	0.026	0.052	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:5gm6P	0.053	0.146	1.968	246	0.046	0.150	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:5mtwC	0.025	0.129	5.094	138	0.007	0.043	5mtwC.pdb.gz	Structural insights into chaperone addiction of toxin-antitoxin systems.
18	PDB:7dgqA5	0.037	0.184	5.094	98	0.016	0.133	7dgqA5.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
19	PDB:7r5jV0	0.079	0.179	6.564	273	0.049	0.143	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7pksk	0.029	0.049	6.993	458	0.010	0.017	7pksk.pdb.gz	Structural basis of Integrator-mediated transcription regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43290	0.0	1607	800	1.000	1.000	SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1
2	Q9VKD8	3.87e-123	395	964	0.380	0.315	Q9VKD8_DROME RE11167p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6686 PE=1 SV=1
3	Q95TU2	4.41e-123	395	970	0.380	0.313	Q95TU2_DROME LD23187p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6686 PE=1 SV=1
4	Q8T064	1.44e-64	221	357	0.154	0.345	Q8T064_DROME LD24604p OS=Drosophila melanogaster OX=7227 GN=CG6686 PE=2 SV=1
5	Q9LFE0	3.18e-26	117	820	0.098	0.095	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
6	O94538	5.82e-11	68.6	649	0.084	0.103	SNU66_SCHPO U4/U6.U5 tri-snRNP-associated protein snu66 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snu66 PE=1 SV=1
7	Q12420	2.85e-06	53.1	587	0.029	0.039	SNU66_YEAST 66 kDa U4/U6.U5 small nuclear ribonucleoprotein component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNU66 PE=1 SV=1
8	Q00975	0.24	37.7	2339	0.034	0.012	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
9	G3I1T3	1.6	35.0	2352	0.031	0.011	G3I1T3_CRIGR ATP-sensitive inward rectifier potassium channel 11 (Fragment) OS=Cricetulus griseus OX=10029 GN=I79_017352 PE=1 SV=1
10	Q14669	3.3	33.9	1992	0.021	0.009	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
11	Q05152	3.7	33.9	2339	0.030	0.010	CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus OX=9986 GN=CACNA1B PE=1 SV=1
12	F4K128	3.8	33.5	1064	0.025	0.019	CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana OX=3702 GN=CHR23 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19252 HIND	2e-09	47.9	HIND motif
2	PF03343 SART-1	6.6e-134	459.4	SART-1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215793	0.999	Splicing factor 3A subunit 1
2	9606.ENSP00000215829	0.999	Small nuclear ribonucleoprotein Sm D3
3	9606.ENSP00000216252	0.999	PHD finger-like domain-containing protein 5A
4	9606.ENSP00000221494	0.999	Splicing factor 3A subunit 2
5	9606.ENSP00000252622	0.999	U6 snRNA-associated Sm-like protein LSm7
6	9606.ENSP00000254193	0.999	U2 small nuclear ribonucleoprotein A
7	9606.ENSP00000266079	0.999	Pre-mRNA-processing factor 6
8	9606.ENSP00000267812	0.999	Microfibrillar-associated protein 1
9	9606.ENSP00000269601	0.999	Thioredoxin-like protein 4A
10	9606.ENSP00000271628	0.999	Splicing factor 3B subunit 4
11	9606.ENSP00000272348	0.999	Small nuclear ribonucleoprotein G
12	9606.ENSP00000274712	0.999	Zinc finger matrin-type 2
13	9606.ENSP00000302160	0.999	U6 snRNA-associated Sm-like protein LSm3
14	9606.ENSP00000305790	0.999	Splicing factor 3B subunit 3
15	9606.ENSP00000315379	0.999	U4/U6 small nuclear ribonucleoprotein Prp3
16	9606.ENSP00000317123	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
17	9606.ENSP00000318861	0.999	Splicing factor 3B subunit 2
18	9606.ENSP00000324122	0.999	U4/U6 small nuclear ribonucleoprotein Prp31
19	9606.ENSP00000335321	0.999	Splicing factor 3B subunit 1
20	9606.ENSP00000342374	0.999	Small nuclear ribonucleoprotein Sm D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0006397	0.989	mRNA processing
GO:0000377	0.986	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0050789	0.977	regulation of biological process
GO:0000398	0.974	mRNA splicing, via spliceosome
GO:0050794	0.955	regulation of cellular process
GO:0071840	0.936	cellular component organization or biogenesis
GO:0016043	0.931	cellular component organization
GO:0048518	0.809	positive regulation of biological process
GO:0065003	0.782	protein-containing complex assembly
GO:0022613	0.763	ribonucleoprotein complex biogenesis
GO:0048522	0.694	positive regulation of cellular process
GO:0071826	0.680	ribonucleoprotein complex subunit organization
GO:0022618	0.665	ribonucleoprotein complex assembly
GO:0000387	0.363	spliceosomal snRNP assembly
GO:0002682	0.343	regulation of immune system process
GO:0030155	0.319	regulation of cell adhesion
GO:0022407	0.305	regulation of cell-cell adhesion
GO:0002684	0.305	positive regulation of immune system process
GO:0060284	0.305	regulation of cell development
GO:0045785	0.305	positive regulation of cell adhesion
GO:0051249	0.305	regulation of lymphocyte activation
GO:0050867	0.305	positive regulation of cell activation
GO:0045597	0.303	positive regulation of cell differentiation
GO:1903037	0.302	regulation of leukocyte cell-cell adhesion
GO:0050863	0.302	regulation of T cell activation
GO:0051251	0.302	positive regulation of lymphocyte activation
GO:0022409	0.301	positive regulation of cell-cell adhesion
GO:1902105	0.301	regulation of leukocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0071005	0.996	U2-type precatalytic spliceosome
GO:0016607	0.996	nuclear speck
GO:1902494	0.995	catalytic complex
GO:0046540	0.995	U4/U6 x U5 tri-snRNP complex
GO:0071013	0.993	catalytic step 2 spliceosome
GO:0012505	0.990	endomembrane system
GO:0015030	0.949	Cajal body
GO:0005794	0.927	Golgi apparatus
GO:0043228	0.343	non-membrane-bounded organelle
GO:0043232	0.331	intracellular non-membrane-bounded organelle
GO:0016020	0.303	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]