StarFunc result for job id O43291

User Input

>input (252 residues)
MAQLCGLRRSRAFLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTD
GSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSE
DHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACM
LRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGD
DKEQLVKNTYVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43291	1.000	1.000	3.180E-44	252	1.000	1.000	O43291.pdb.gz	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
2	AFDB:Q9WU03	0.521	0.521	1.325E-31	252	0.706	0.706	Q9WU03.pdb.gz	SPIT2_MOUSE Kunitz-type protease inhibitor 2 OS=Mus musculus OX=10090 GN=Spint2 PE=1 SV=1
3	AFDB:G3V8S0	0.394	0.397	5.775E-30	250	0.683	0.688	G3V8S0.pdb.gz	G3V8S0_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=2
4	AFDB:Q6P796	0.440	0.558	3.661E-17	193	0.496	0.648	Q6P796.pdb.gz	Q6P796_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
5	AFDB:P10646	0.278	0.237	3.819E-14	304	0.190	0.158	P10646.pdb.gz	TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1
6	AFDB:Q02445	0.236	0.200	4.571E-14	302	0.183	0.152	Q02445.pdb.gz	TFPI1_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi PE=2 SV=1
7	AFDB:P86733	0.222	0.440	1.266E-13	126	0.175	0.349	P86733.pdb.gz	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
8	AFDB:O43278	0.243	0.126	1.813E-13	529	0.278	0.132	O43278.pdb.gz	SPIT1_HUMAN Kunitz-type protease inhibitor 1 OS=Homo sapiens OX=9606 GN=SPINT1 PE=1 SV=2
9	AFDB:O54819	0.213	0.176	2.447E-13	306	0.183	0.150	O54819.pdb.gz	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1
10	AFDB:O76840	0.225	0.028	2.758E-13	2167	0.183	0.021	O76840.pdb.gz	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
11	PDB:4bd9B	0.213	0.321	1.715E-11	165	0.187	0.285	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
12	PDB:3bybA	0.209	0.887	1.559E-5	58	0.099	0.431	3bybA.pdb.gz
13	PDB:2m01A	0.194	0.724	7.661E-4	59	0.103	0.441	2m01A.pdb.gz
14	PDB:5mp9M	0.108	0.074	3.795	381	0.028	0.018	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
15	PDB:5ewiL	0.078	0.087	5.120	217	0.032	0.037	5ewiL.pdb.gz
16	PDB:7ajtEH	0.071	0.075	6.128	237	0.004	0.004	7ajtEH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:6wgg2	0.076	0.036	6.506	581	0.004	0.002	6wgg2.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
18	PDB:4d3cL	0.074	0.084	6.908	209	0.032	0.038	4d3cL.pdb.gz
19	PDB:7t31B	0.076	0.042	6.908	497	0.040	0.020	7t31B.pdb.gz
20	PDB:1k4dB	0.074	0.085	7.335	212	0.032	0.038	1k4dB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43291	0.0	521	252	1.000	1.000	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
2	Q9WU03	5.88e-116	334	252	0.706	0.706	SPIT2_MOUSE Kunitz-type protease inhibitor 2 OS=Mus musculus OX=10090 GN=Spint2 PE=1 SV=1
3	F6QKA3	1.33e-113	328	250	0.683	0.688	F6QKA3_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
4	G3V8S0	2.50e-109	317	258	0.619	0.605	G3V8S0_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=2
5	Q6P796	3.95e-73	223	193	0.425	0.554	Q6P796_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
6	Q4V8Q2	6.05e-28	113	507	0.313	0.156	Q4V8Q2_RAT Serine peptidase inhibitor, Kunitz type 1 OS=Rattus norvegicus OX=10116 GN=Spint1 PE=4 SV=1
7	Q9R097	1.71e-27	112	507	0.302	0.150	SPIT1_MOUSE Kunitz-type protease inhibitor 1 OS=Mus musculus OX=10090 GN=Spint1 PE=1 SV=2
8	A0A2R8QCE4	2.13e-25	106	523	0.317	0.153	A0A2R8QCE4_DANRE Serine peptidase inhibitor, Kunitz type 1 a OS=Danio rerio OX=7955 GN=cb376 PE=1 SV=1
9	O43278	2.68e-25	105	529	0.246	0.117	SPIT1_HUMAN Kunitz-type protease inhibitor 1 OS=Homo sapiens OX=9606 GN=SPINT1 PE=1 SV=2
10	A9JR82	2.31e-24	103	499	0.238	0.120	A9JR82_DANRE Serine peptidase inhibitor, Kunitz type 1 b precursor OS=Danio rerio OX=7955 GN=spint1b PE=1 SV=1
11	P84875	2.83e-24	97.1	165	0.206	0.315	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
12	Q7T363	5.07e-24	102	516	0.306	0.149	Q7T363_DANRE Serine peptidase inhibitor, Kunitz type 1 a precursor OS=Danio rerio OX=7955 GN=zgc:64075 PE=1 SV=1
13	P86733	9.33e-21	86.7	126	0.202	0.405	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
14	O54819	1.88e-20	90.1	306	0.218	0.180	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1
15	Q02445	2.20e-19	87.4	302	0.206	0.172	TFPI1_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi PE=2 SV=1
16	P10646	1.48e-18	85.1	304	0.202	0.168	TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1
17	P02760	4.00e-18	84.3	352	0.190	0.136	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
18	Q64240	6.78e-18	83.6	349	0.190	0.138	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
19	Q868Z9	7.09e-18	85.1	2898	0.187	0.016	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
20	Q1WCN6	7.20e-18	82.0	233	0.206	0.223	Q1WCN6_DANRE Tissue factor pathway inhibitor OS=Danio rerio OX=7955 GN=si:ch211-262k23.2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00014 Kunitz_BPTI	1.6e-31	119.6	Kunitz/Bovine pancreatic trypsin inhibitor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222390	0.955	Hepatocyte growth factor
2	9606.ENSP00000414287	0.914	Hepatocyte growth factor-like protein
3	9606.ENSP00000421801	0.895	Hepatocyte growth factor activator
4	9606.ENSP00000278742	0.856	Suppressor of tumorigenicity 14 protein
5	9606.ENSP00000319730	0.847	Prostasin
6	9606.ENSP00000263735	0.821	Epithelial cell adhesion molecule
7	9606.ENSP00000301246	0.770	Immortalization up-regulated protein
8	9606.ENSP00000354280	0.752	Trypsin-3
9	9606.ENSP00000262626	0.741	Serine protease hepsin
10	9606.ENSP00000434279	0.726	Transmembrane protease serine 13
11	9606.ENSP00000375678	0.721	Kallikrein-14
12	9606.ENSP00000301908	0.686	Prepronociceptin
13	9606.ENSP00000336764	0.654	Nociceptin receptor
14	9606.ENSP00000285039	0.649	Unconventional myosin-Vb
15	9606.ENSP00000440185	0.607	Proenkephalin-B
16	9606.ENSP00000394624	0.603	Mu-type opioid receptor
17	9606.ENSP00000301242	0.573	Protein phosphatase 1 regulatory subunit 14A
18	9606.ENSP00000229729	0.571	Choline transporter-like protein 4
19	9606.ENSP00000353475	0.554	Claudin-7
20	9606.ENSP00000261170	0.550	Heat-stable enterotoxin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	0.999	serine-type endopeptidase inhibitor activity
GO:0005515	0.915	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.876	cellular process
GO:0048523	0.861	negative regulation of cellular process
GO:0042127	0.821	regulation of cell population proliferation
GO:0040012	0.688	regulation of locomotion
GO:0008285	0.653	negative regulation of cell population proliferation
GO:0030155	0.593	regulation of cell adhesion
GO:0050896	0.537	response to stimulus
GO:2000145	0.518	regulation of cell motility
GO:0032501	0.432	multicellular organismal process
GO:0040013	0.427	negative regulation of locomotion
GO:0048856	0.376	anatomical structure development
GO:0048518	0.333	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005622	0.976	intracellular anatomical structure
GO:0005576	0.966	extracellular region
GO:0005737	0.958	cytoplasm
GO:0071944	0.957	cell periphery
GO:0005886	0.931	plasma membrane
GO:0005615	0.856	extracellular space
GO:0043226	0.786	organelle
GO:0043227	0.713	membrane-bounded organelle
GO:0043229	0.705	intracellular organelle
GO:0043231	0.602	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]