StarFunc result for job id O43292

User Input

>input (621 residues)
MGLLSDPVRRRALARLVLRLNAPLCVLSYVAGIAWFLALVFPPLTQRTYMSENAMGSTMV
EEQFAGGDRARAFARDFAAHRKKSGALPVAWLERTMRSVGLEVYTQSFSRKLPFPDETHE
RYMVSGTNVYGILRAPRAASTESLVLTVPCGSDSTNSQAVGLLLALAAHFRGQIYWAKDI
VFLVTEHDLLGTEAWLEAYHDVNVTGMQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVE
GLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPLQGLQTLLLMVLRQASG
RPHGSHGLFLRYRVEALTLRGINSFRQYKYDLVAVGKALEGMFRKLNHLLERLHQSFFLY
LLPGLSRFVSIGLYMPAVGFLLLVLGLKALELWMQLHEAGMGLEEPGGAPGPSVPLPPSQ
GVGLASLVAPLLISQAMGLALYVLPVLGQHVATQHFPVAEAEAVVLTLLAIYAAGLALPH
NTHRVVSTQAPDRGWMALKLVALIYLALQLGCIALTNFSLGFLLATTMVPTAALAKPHGP
RTLYAALLVLTSPAATLLGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLF
PLLSLGLYPCWLLFWNVLFWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43292	1.000	1.000	7.748E-102	621	1.000	1.000	O43292.pdb.gz	GPAA1_HUMAN Glycosylphosphatidylinositol anchor attachment 1 protein OS=Homo sapiens OX=9606 GN=GPAA1 PE=1 SV=3
2	PDB:7w72A	0.933	0.985	1.492E-80	588	0.945	0.998	7w72A.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
3	AFDB:Q9W464	0.858	0.793	2.244E-43	674	0.330	0.304	Q9W464.pdb.gz	Q9W464_DROME Glycosylphosphatidylinositol anchor attachment 1 OS=Drosophila melanogaster OX=7227 GN=GAA1 PE=1 SV=1
4	AFDB:Q9US48	0.775	0.826	2.642E-34	581	0.246	0.263	Q9US48.pdb.gz	GAA1_SCHPO GPI transamidase component gaa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaa1 PE=3 SV=1
5	AFDB:F4JZM4	0.776	0.696	1.257E-31	699	0.266	0.236	F4JZM4.pdb.gz	F4JZM4_ARATH GPI transamidase component family protein / Gaa1-like family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19130 PE=1 SV=1
6	AFDB:E9PQ31	0.416	0.917	1.652E-30	273	0.433	0.985	E9PQ31.pdb.gz	E9PQ31_HUMAN Glycosylphosphatidylinositol anchor attachment 1 (Fragment) OS=Homo sapiens OX=9606 GN=GPAA1 PE=1 SV=3
7	AFDB:P39012	0.761	0.770	1.436E-29	614	0.237	0.239	P39012.pdb.gz	GAA1_YEAST GPI transamidase component GAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAA1 PE=1 SV=1
8	AFDB:Q38CL7	0.481	0.624	1.384E-13	461	0.150	0.202	Q38CL7.pdb.gz	Q38CL7_TRYB2 GPI transamidase component GAA1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0100 PE=4 SV=1
9	AFDB:C0H5L4	0.616	0.498	1.910E-13	795	0.172	0.135	C0H5L4.pdb.gz	C0H5L4_PLAF7 Glycosylphosphatidylinositol anchor attachment 1 protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1369000 PE=4 SV=1
10	AFDB:P10423	0.284	0.487	6.833E-7	345	0.066	0.119	P10423.pdb.gz	IAP_ECOLI Alkaline phosphatase isozyme conversion protein OS=Escherichia coli (strain K12) OX=83333 GN=iap PE=3 SV=1
11	PDB:4f9vA	0.272	0.508	1.585E-6	307	0.060	0.121	4f9vA.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
12	AFDB:Q9UQQ1	0.228	0.197	7.474E-6	740	0.110	0.092	Q9UQQ1.pdb.gz	NALDL_HUMAN Aminopeptidase NAALADL1 OS=Homo sapiens OX=9606 GN=NAALADL1 PE=1 SV=2
13	PDB:7d21A	0.277	0.491	1.256E-5	328	0.077	0.146	7d21A.pdb.gz	A Unique Carboxylic-Acid Hydrogen-Bond Network (CAHBN) Confers Glutaminyl Cyclase Activity on M28 Family Enzymes.
14	PDB:4faiB	0.256	0.466	1.990E-5	305	0.074	0.151	4faiB.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
15	PDB:4tweA	0.214	0.191	3.011E-5	706	0.103	0.091	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
16	PDB:7zqsB	0.188	0.183	5.229E-5	639	0.092	0.089	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
17	PDB:6etyA	0.214	0.194	6.003E-5	696	0.097	0.086	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
18	PDB:3fedA	0.198	0.180	9.958E-5	690	0.077	0.070	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
19	PDB:6yi1A	0.247	0.429	1.578E-4	329	0.069	0.131	6yi1A.pdb.gz	Hydrazides Are Potent Transition-State Analogues for Glutaminyl Cyclase Implicated in the Pathogenesis of Alzheimer's Disease.
20	PDB:4ksiA	0.247	0.286	1.371E-3	517	0.066	0.079	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZZA0	0.0	956	561	0.799	0.884	A0A8I5ZZA0_RAT Glycosylphosphatidylinositol anchor attachment 1 OS=Rattus norvegicus OX=10116 GN=Gpaa1 PE=1 SV=1
2	A0A8I6A119	0.0	1081	589	0.884	0.932	A0A8I6A119_RAT Glycosylphosphatidylinositol anchor attachment 1 OS=Rattus norvegicus OX=10116 GN=Gpaa1 PE=1 SV=1
3	A0A8I6GMH5	0.0	1035	596	0.852	0.888	A0A8I6GMH5_RAT Glycosylphosphatidylinositol anchor attachment 1 OS=Rattus norvegicus OX=10116 GN=Gpaa1 PE=1 SV=1
4	E9PPZ9	0.0	515	260	0.414	0.988	E9PPZ9_HUMAN Glycosylphosphatidylinositol anchor attachment 1 OS=Homo sapiens OX=9606 GN=GPAA1 PE=1 SV=2
5	F7EVW7	0.0	1108	619	0.913	0.916	F7EVW7_RAT Glycosylphosphatidylinositol anchor attachment 1 OS=Rattus norvegicus OX=10116 GN=Gpaa1 PE=1 SV=1
6	O43292	0.0	1239	621	1.000	1.000	GPAA1_HUMAN Glycosylphosphatidylinositol anchor attachment 1 protein OS=Homo sapiens OX=9606 GN=GPAA1 PE=1 SV=3
7	Q6AYM8	0.0	1115	621	0.918	0.918	Q6AYM8_RAT Glycosylphosphatidylinositol anchor attachment protein 1 homolog (Yeast) OS=Rattus norvegicus OX=10116 GN=Gpaa1 PE=2 SV=1
8	Q9WTK3	0.0	1116	621	0.913	0.913	GPAA1_MOUSE Glycosylphosphatidylinositol anchor attachment 1 protein OS=Mus musculus OX=10090 GN=Gpaa1 PE=1 SV=3
9	E9PQ31	3.79e-130	385	273	0.316	0.718	E9PQ31_HUMAN Glycosylphosphatidylinositol anchor attachment 1 (Fragment) OS=Homo sapiens OX=9606 GN=GPAA1 PE=1 SV=3
10	Q961V1	7.59e-80	265	561	0.325	0.360	Q961V1_DROME GH05723p OS=Drosophila melanogaster OX=7227 GN=GAA1 PE=2 SV=1
11	Q9W464	2.43e-79	266	674	0.356	0.328	Q9W464_DROME Glycosylphosphatidylinositol anchor attachment 1 OS=Drosophila melanogaster OX=7227 GN=GAA1 PE=1 SV=1
12	Q9US48	2.46e-48	180	581	0.250	0.267	GAA1_SCHPO GPI transamidase component gaa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaa1 PE=3 SV=1
13	P39012	1.81e-42	164	614	0.245	0.248	GAA1_YEAST GPI transamidase component GAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAA1 PE=1 SV=1
14	F4JZM4	1.96e-34	141	699	0.240	0.213	F4JZM4_ARATH GPI transamidase component family protein / Gaa1-like family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19130 PE=1 SV=1
15	C0H5L4	1.46e-05	50.4	795	0.061	0.048	C0H5L4_PLAF7 Glycosylphosphatidylinositol anchor attachment 1 protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1369000 PE=4 SV=1
16	Q38CL7	0.018	40.4	461	0.084	0.113	Q38CL7_TRYB2 GPI transamidase component GAA1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0100 PE=4 SV=1
17	Q7YTW5	0.033	39.7	461	0.084	0.113	Q7YTW5_TRYBB GPI transamidase component GAA1 OS=Trypanosoma brucei brucei OX=5702 GN=TbGAA1 PE=4 SV=1
18	V6CLP5	0.31	37.0	4963	0.063	0.008	KETN1_CAEEL Kettin homolog OS=Caenorhabditis elegans OX=6239 GN=ketn-1 PE=1 SV=1
19	Q9SX38	0.79	35.4	857	0.050	0.036	DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana OX=3702 GN=At1g50180 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04114 Gaa1	1.6e-151	517.4	Gaa1-like, GPI transamidase component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347206

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279036	0.999	GPI transamidase component PIG-T
2	9606.ENSP00000359848	0.999	GPI-anchor transamidase
3	9606.ENSP00000217446	0.998	Phosphatidylinositol glycan anchor biosynthesis class U protein
4	9606.ENSP00000309430	0.997	GPI transamidase component PIG-S
5	9606.ENSP00000346809	0.980	GPI inositol-deacylase
6	9606.ENSP00000367880	0.950	GPI ethanolamine phosphate transferase 3
7	9606.ENSP00000339328	0.909	Urokinase plasminogen activator surface receptor
8	9606.ENSP00000363260	0.879	GPI mannosyltransferase 2
9	9606.ENSP00000281382	0.863	Phosphatidylinositol-glycan biosynthesis class F protein
10	9606.ENSP00000315476	0.863	Exosome complex component RRP41
11	9606.ENSP00000164305	0.860	GPI mannosyltransferase 3
12	9606.ENSP00000225609	0.857	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
13	9606.ENSP00000357069	0.848	GPI mannosyltransferase 1
14	9606.ENSP00000420037	0.829	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
15	9606.ENSP00000369820	0.820	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
16	9606.ENSP00000413405	0.802	GPI mannosyltransferase 4
17	9606.ENSP00000356702	0.799	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
18	9606.ENSP00000250124	0.775	Mannose-P-dolichol utilization defect 1 protein
19	9606.ENSP00000216452	0.748	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
20	9606.ENSP00000376911	0.731	Legumain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0005488	0.995	binding
GO:0005515	0.992	protein binding
GO:0003923	0.891	GPI-anchor transamidase activity
GO:0051861	0.744	glycolipid binding
GO:0035091	0.737	phosphatidylinositol binding
GO:0034235	0.578	GPI anchor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044249	0.988	cellular biosynthetic process
GO:0019538	0.988	protein metabolic process
GO:0044260	0.986	cellular macromolecule metabolic process
GO:1901566	0.986	organonitrogen compound biosynthetic process
GO:0043412	0.984	macromolecule modification
GO:0006629	0.983	lipid metabolic process
GO:1901137	0.981	carbohydrate derivative biosynthetic process
GO:0044255	0.974	cellular lipid metabolic process
GO:0036211	0.973	protein modification process
GO:0034645	0.967	cellular macromolecule biosynthetic process
GO:0008610	0.924	lipid biosynthetic process
GO:0090407	0.920	organophosphate biosynthetic process
GO:0046467	0.902	membrane lipid biosynthetic process
GO:0006796	0.897	phosphate-containing compound metabolic process
GO:0006664	0.865	glycolipid metabolic process
GO:0046474	0.865	glycerophospholipid biosynthetic process
GO:0006506	0.864	GPI anchor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042765	0.999	GPI-anchor transamidase complex
GO:0005829	0.434	cytosol
GO:0043232	0.396	intracellular non-membrane-bounded organelle
GO:0005739	0.371	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]