StarFunc result for job id O43293

User Input

>input (454 residues)
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43293	1.000	1.000	1.239E-75	454	1.000	1.000	O43293.pdb.gz	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1
2	AFDB:E9QHI3	0.887	0.889	9.399E-67	453	0.804	0.806	E9QHI3.pdb.gz	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
3	AFDB:O54784	0.723	0.732	3.820E-64	448	0.835	0.846	O54784.pdb.gz	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
4	AFDB:Q80YE7	0.640	0.204	9.914E-49	1442	0.511	0.161	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
5	AFDB:A0A024R603	0.642	0.786	6.823E-48	370	0.496	0.608	A0A024R603.pdb.gz
6	PDB:2yaaA	0.634	0.955	2.117E-44	300	0.491	0.743	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
7	AFDB:O94768	0.565	0.686	1.092E-31	372	0.286	0.349	O94768.pdb.gz	ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1
8	AFDB:Q9UEE5	0.571	0.625	2.637E-31	414	0.282	0.309	Q9UEE5.pdb.gz	ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2
9	AFDB:O01653	0.612	0.341	3.111E-31	832	0.275	0.150	O01653.pdb.gz	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
10	AFDB:A1ZA70	0.599	0.376	5.703E-31	732	0.269	0.167	A1ZA70.pdb.gz	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2
11	AFDB:A1ZA69	0.602	0.300	6.026E-31	929	0.269	0.131	A1ZA69.pdb.gz	A1ZA69_DROME Stretchin-Mlck, isoform B OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
12	PDB:5u6yA	0.578	0.571	7.326E-28	459	0.233	0.231	5u6yA.pdb.gz
13	PDB:8bfsA	0.529	0.845	2.524E-25	274	0.244	0.405	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:3soaA	0.579	0.602	3.513E-25	436	0.231	0.241	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
15	PDB:2x4fA	0.552	0.850	7.598E-25	289	0.258	0.405	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
16	PDB:4rgjA	0.527	0.517	7.880E-22	463	0.218	0.214	4rgjA.pdb.gz
17	PDB:7myjC	0.511	0.499	1.527E-21	465	0.203	0.198	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
18	PDB:4zhxA	0.514	0.568	2.507E-21	409	0.209	0.232	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:6b1uA	0.512	0.526	2.799E-21	442	0.222	0.229	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:5ufuA	0.526	0.642	7.549E-21	369	0.196	0.241	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QHI3	0.0	766	453	0.804	0.806	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
2	O43293	0.0	924	454	1.000	1.000	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1
3	O54784	0.0	745	448	0.839	0.850	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
4	O88764	0.0	744	448	0.837	0.848	DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Dapk3 PE=1 SV=1
5	Q8VDF3	9.46e-167	475	370	0.504	0.619	DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Dapk2 PE=1 SV=1
6	Q9UIK4	1.19e-164	470	370	0.496	0.608	DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=DAPK2 PE=1 SV=1
7	P53355	4.46e-162	496	1430	0.500	0.159	DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6
8	Q80YE7	8.02e-162	495	1442	0.502	0.158	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
9	Q91XS8	1.65e-86	271	371	0.289	0.353	ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus OX=10116 GN=Stk17b PE=1 SV=1
10	O94768	2.44e-84	265	372	0.286	0.349	ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1
11	Q9GM70	3.69e-82	260	397	0.275	0.315	ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus OX=9986 GN=STK17A PE=2 SV=1
12	Q9UEE5	1.34e-81	259	414	0.278	0.304	ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2
13	G1U9Q7	1.23e-79	271	1903	0.293	0.070	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
14	Q6PDN3	9.48e-79	269	1941	0.291	0.068	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
15	Q15746	2.15e-78	268	1914	0.291	0.069	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
16	G4SLH0	1.22e-77	266	18562	0.267	0.007	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
17	Q86YV6	5.27e-76	244	388	0.264	0.309	MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens OX=9606 GN=MYLK4 PE=1 SV=2
18	Q3UIZ8	3.74e-75	252	795	0.284	0.162	MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus OX=10090 GN=Mylk3 PE=1 SV=1
19	Q32MK0	6.68e-75	252	819	0.282	0.156	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
20	E9PT87	1.06e-74	251	786	0.275	0.159	MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus OX=10116 GN=Mylk3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.4	19.5	ABC1 atypical kinase-like domain
2	PF01633 Choline_kinase	3.8	18.6	Choline/ethanolamine kinase
3	PF13095 FTA2	22	16.2	Kinetochore Sim4 complex subunit FTA2
4	PF06293 Kdo	0.00061	30.8	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF00069 Pkinase	3.5e-72	254.5	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	2.7e-33	126.9	Protein tyrosine and serine/threonine kinase
7	PF01163 RIO1	0.37	21.9	RIO1 family
8	PF19974 TCAD9	90	13.5	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442973

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
2	9606.ENSP00000328088	0.867	PRKC apoptosis WT1 regulator protein
3	9606.ENSP00000215832	0.862	Mitogen-activated protein kinase 1
4	9606.ENSP00000263025	0.861	Mitogen-activated protein kinase 3
5	9606.ENSP00000355231	0.860	Beclin-1
6	9606.ENSP00000300258	0.848	T-complex protein 10A homolog 2
7	9606.ENSP00000261891	0.807	Death-associated protein kinase 2
8	9606.ENSP00000386135	0.807	Death-associated protein kinase 1
9	9606.ENSP00000480091	0.755	Nicotinamide riboside kinase 2
10	9606.ENSP00000389168	0.741	Protein phosphatase 1 regulatory subunit 12A
11	9606.ENSP00000477848	0.721	Protein AATF
12	9606.ENSP00000264657	0.712	Signal transducer and activator of transcription 3
13	9606.ENSP00000463559	0.710	Myosin regulatory light chain 12B
14	9606.ENSP00000334329	0.703	Netrin receptor UNC5B
15	9606.ENSP00000311032	0.697	Caspase-3
16	9606.ENSP00000363668	0.693	Death domain-associated protein 6
17	9606.ENSP00000308576	0.690	Rho-related GTP-binding protein RhoD
18	9606.ENSP00000469591	0.681	Zinc finger protein 628
19	9606.ENSP00000258149	0.661	E3 ubiquitin-protein ligase Mdm2
20	9606.ENSP00000336790	0.651	Cyclic AMP-dependent transcription factor ATF-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	0.996	ATP binding
GO:0019899	0.466	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.987	cellular metabolic process
GO:0050896	0.986	response to stimulus
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0071704	0.975	organic substance metabolic process
GO:0006468	0.967	protein phosphorylation
GO:0051716	0.915	cellular response to stimulus
GO:0019222	0.871	regulation of metabolic process
GO:0006915	0.864	apoptotic process
GO:0048518	0.836	positive regulation of biological process
GO:0048522	0.816	positive regulation of cellular process
GO:0031323	0.795	regulation of cellular metabolic process
GO:0010941	0.794	regulation of cell death
GO:0035556	0.783	intracellular signal transduction
GO:0006950	0.751	response to stress
GO:0048583	0.735	regulation of response to stimulus
GO:0051171	0.690	regulation of nitrogen compound metabolic process
GO:0060255	0.688	regulation of macromolecule metabolic process
GO:0080090	0.674	regulation of primary metabolic process
GO:0048523	0.591	negative regulation of cellular process
GO:0002376	0.589	immune system process
GO:0023051	0.469	regulation of signaling
GO:0010646	0.466	regulation of cell communication
GO:0042221	0.465	response to chemical
GO:0070887	0.439	cellular response to chemical stimulus
GO:0010468	0.427	regulation of gene expression
GO:0043067	0.425	regulation of programmed cell death
GO:0009893	0.417	positive regulation of metabolic process
GO:0009889	0.415	regulation of biosynthetic process
GO:0042981	0.410	regulation of apoptotic process
GO:0010033	0.406	response to organic substance
GO:0010556	0.395	regulation of macromolecule biosynthetic process
GO:0031326	0.393	regulation of cellular biosynthetic process
GO:0071310	0.387	cellular response to organic substance
GO:0051246	0.379	regulation of protein metabolic process
GO:0009966	0.330	regulation of signal transduction
GO:0019219	0.330	regulation of nucleobase-containing compound metabolic process
GO:0048584	0.328	positive regulation of response to stimulus
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0009892	0.303	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.981	cytosol
GO:0005654	0.981	nucleoplasm
GO:0016020	0.633	membrane
GO:0043232	0.315	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]