StarFunc result for job id O43294

User Input

>input (461 residues)
MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
ASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPT
QPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
TALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43294	1.000	1.000	9.447E-84	461	1.000	1.000	O43294.pdb.gz	TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2
2	AFDB:Q66H76	0.501	0.404	5.679E-46	586	0.527	0.415	Q66H76.pdb.gz	PAXI_RAT Paxillin OS=Rattus norvegicus OX=10116 GN=Pxn PE=1 SV=1
3	AFDB:Q6R3L1	0.520	0.456	2.662E-44	533	0.510	0.441	Q6R3L1.pdb.gz	Q6R3L1_DANRE Paxillin OS=Danio rerio OX=7955 GN=pxn PE=1 SV=1
4	AFDB:A0A140VJQ8	0.500	0.400	1.433E-43	591	0.482	0.376	A0A140VJQ8.pdb.gz	A0A140VJQ8_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=2 SV=1
5	AFDB:P49024	0.538	0.450	1.616E-43	559	0.469	0.386	P49024.pdb.gz	PAXI_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=1 SV=1
6	AFDB:E7F7U1	0.526	0.468	2.948E-43	525	0.479	0.421	E7F7U1.pdb.gz
7	AFDB:A0A1B0GTU4	0.495	0.227	1.225E-41	1081	0.425	0.181	A0A1B0GTU4.pdb.gz	A0A1B0GTU4_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
8	AFDB:Q99N69	0.509	0.600	2.476E-40	386	0.393	0.469	Q99N69.pdb.gz	LPXN_MOUSE Leupaxin OS=Mus musculus OX=10090 GN=Lpxn PE=1 SV=2
9	AFDB:O60711	0.500	0.588	8.240E-40	386	0.397	0.474	O60711.pdb.gz	LPXN_HUMAN Leupaxin OS=Homo sapiens OX=9606 GN=LPXN PE=1 SV=1
10	AFDB:Q09476	0.475	0.526	5.343E-36	413	0.325	0.363	Q09476.pdb.gz	PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=pxl-1 PE=1 SV=2
11	PDB:4kfzB	0.136	0.376	8.920E-8	148	0.080	0.250	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.133	0.306	6.255E-5	192	0.076	0.182	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.125	0.587	1.707E-3	76	0.048	0.289	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4r8pL	0.075	0.123	1.522	254	0.022	0.039	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:5gm6a	0.066	0.216	1.522	123	0.035	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7n9sA	0.068	0.024	2.462	2365	0.054	0.011	7n9sA.pdb.gz
17	PDB:7jtkG	0.052	0.055	3.325	421	0.037	0.040	7jtkG.pdb.gz
18	PDB:7b5lH	0.064	0.070	3.531	423	0.022	0.024	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
19	PDB:7uhyD	0.092	0.139	3.750	288	0.026	0.042	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:4wa6D	0.060	0.066	3.983	415	0.030	0.034	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43294	0.0	933	461	1.000	1.000	TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2
2	Q62219	0.0	820	461	0.913	0.913	TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus OX=10090 GN=Tgfb1i1 PE=1 SV=2
3	Q99PD6	0.0	815	461	0.915	0.915	TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus OX=10116 GN=Tgfb1i1 PE=1 SV=2
4	F1NB68	8.01e-144	424	557	0.488	0.404	F1NB68_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=3 SV=4
5	P49024	1.71e-143	424	559	0.488	0.403	PAXI_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=1 SV=1
6	G1N9N2	2.42e-143	423	557	0.488	0.404	G1N9N2_MELGA Paxillin OS=Meleagris gallopavo OX=9103 GN=PXN PE=3 SV=2
7	Q6R3L1	2.69e-142	419	533	0.408	0.353	Q6R3L1_DANRE Paxillin OS=Danio rerio OX=7955 GN=pxn PE=1 SV=1
8	F5GZ78	5.95e-137	408	589	0.492	0.385	F5GZ78_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
9	Q66H76	3.47e-135	403	586	0.425	0.334	PAXI_RAT Paxillin OS=Rattus norvegicus OX=10116 GN=Pxn PE=1 SV=1
10	Q8VI36	2.01e-133	399	591	0.427	0.333	PAXI_MOUSE Paxillin OS=Mus musculus OX=10090 GN=Pxn PE=1 SV=1
11	D3DMM0	4.51e-132	394	563	0.406	0.332	D3DMM0_DROME MIP15702p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
12	A0A140VJQ8	5.68e-132	395	591	0.416	0.325	A0A140VJQ8_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=2 SV=1
13	P49023	5.68e-132	395	591	0.416	0.325	PAXI_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3
14	Q9VIX3	6.74e-132	394	556	0.406	0.336	Q9VIX3_DROME Paxillin, isoform B OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=2
15	Q8INW7	7.26e-132	394	557	0.406	0.336	Q8INW7_DROME FI11475p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
16	Q8MQX3	7.26e-132	394	557	0.406	0.336	Q8MQX3_DROME SD04793p OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=1
17	Q9BPQ9	1.07e-131	394	581	0.406	0.322	Q9BPQ9_DROME Paxillin OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=2
18	F1MFD1	1.34e-131	394	586	0.430	0.338	F1MFD1_BOVIN Paxillin OS=Bos taurus OX=9913 GN=PXN PE=1 SV=3
19	Q9VIX2	1.43e-131	394	581	0.406	0.322	Q9VIX2_DROME LD06038p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=3
20	Q2PDT4	1.68e-131	394	581	0.406	0.322	Q2PDT4_DROME Paxillin, isoform F OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07793 DUF1631	5.5e+02	10.4	Protein of unknown function (DUF1631)
2	PF00412 LIM	2.1e-58	205.7	LIM domain
3	PF03535 Paxillin	0.0004	31.9	Paxillin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341189	0.993	Focal adhesion kinase 1
2	9606.ENSP00000363822	0.992	Androgen receptor
3	9606.ENSP00000380638	0.988	Protein-tyrosine kinase 2-beta
4	9606.ENSP00000332973	0.976	Mothers against decapentaplegic homolog 3
5	9606.ENSP00000248553	0.958	Heat shock protein beta-1
6	9606.ENSP00000211998	0.927	Vinculin
7	9606.ENSP00000262395	0.909	TNF receptor-associated factor 4
8	9606.ENSP00000220003	0.887	Tyrosine-protein kinase CSK
9	9606.ENSP00000287820	0.872	Peroxisome proliferator-activated receptor gamma
10	9606.ENSP00000289473	0.865	Neutrophil cytosol factor 1
11	9606.ENSP00000282406	0.862	Pleckstrin homology domain-containing family H member 2
12	9606.ENSP00000171887	0.861	Tensin-1
13	9606.ENSP00000378338	0.845	ARF GTPase-activating protein GIT1
14	9606.ENSP00000231509	0.829	Glucocorticoid receptor
15	9606.ENSP00000400175	0.788	Transforming protein RhoA
16	9606.ENSP00000285735	0.756	Rho-related GTP-binding protein RhoC
17	9606.ENSP00000379975	0.746	Integrin-linked protein kinase
18	9606.ENSP00000391669	0.740	Breast cancer anti-estrogen resistance protein 1
19	9606.ENSP00000263253	0.724	Histone acetyltransferase p300
20	9606.ENSP00000248594	0.722	Tyrosine-protein phosphatase non-receptor type 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.718	signaling receptor binding
GO:0046332	0.712	SMAD binding
GO:0140110	0.645	transcription regulator activity
GO:0003712	0.619	transcription coregulator activity
GO:0140297	0.578	DNA-binding transcription factor binding
GO:0061629	0.560	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003713	0.547	transcription coactivator activity
GO:0016922	0.470	nuclear receptor binding
GO:0050681	0.403	nuclear androgen receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0032501	0.883	multicellular organismal process
GO:0048583	0.865	regulation of response to stimulus
GO:0048518	0.841	positive regulation of biological process
GO:0048522	0.826	positive regulation of cellular process
GO:0048856	0.751	anatomical structure development
GO:0051716	0.751	cellular response to stimulus
GO:0006950	0.726	response to stress
GO:0009966	0.715	regulation of signal transduction
GO:0007154	0.658	cell communication
GO:0007165	0.637	signal transduction
GO:0048519	0.636	negative regulation of biological process
GO:0048523	0.627	negative regulation of cellular process
GO:0019222	0.606	regulation of metabolic process
GO:0050793	0.599	regulation of developmental process
GO:0007166	0.572	cell surface receptor signaling pathway
GO:0008152	0.549	metabolic process
GO:0060255	0.488	regulation of macromolecule metabolic process
GO:0051171	0.486	regulation of nitrogen compound metabolic process
GO:0031323	0.485	regulation of cellular metabolic process
GO:0080090	0.483	regulation of primary metabolic process
GO:0071704	0.471	organic substance metabolic process
GO:0009893	0.462	positive regulation of metabolic process
GO:0044238	0.461	primary metabolic process
GO:0007275	0.455	multicellular organism development
GO:0051173	0.441	positive regulation of nitrogen compound metabolic process
GO:0010604	0.440	positive regulation of macromolecule metabolic process
GO:0048584	0.429	positive regulation of response to stimulus
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0006807	0.424	nitrogen compound metabolic process
GO:0044237	0.385	cellular metabolic process
GO:0009628	0.383	response to abiotic stimulus
GO:0007167	0.379	enzyme-linked receptor protein signaling pathway
GO:0010468	0.363	regulation of gene expression
GO:0010556	0.358	regulation of macromolecule biosynthetic process
GO:0031326	0.358	regulation of cellular biosynthetic process
GO:0071840	0.352	cellular component organization or biogenesis
GO:0019219	0.352	regulation of nucleobase-containing compound metabolic process
GO:0043170	0.342	macromolecule metabolic process
GO:0016043	0.326	cellular component organization
GO:0090092	0.321	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051239	0.312	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	0.999	focal adhesion
GO:0005737	0.867	cytoplasm
GO:0071944	0.819	cell periphery
GO:0005829	0.727	cytosol
GO:0016020	0.615	membrane
GO:0043229	0.440	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]