StarFunc result for job id O43295

User Input

>input (1099 residues)
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
VIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRYH
QLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTRP
PCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLENPAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSPH
SEPGAIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE
HISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIP
LTRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEAL
AEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPVSSEPASPLHTIVIRD
PDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSPA
VTPTEKMFPNSSADKSGTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43295	0.999	0.999	0.000	1099	1.000	1.000	O43295.pdb.gz	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
2	AFDB:Q7Z6B7	0.433	0.439	2.642E-100	1085	0.679	0.688	Q7Z6B7.pdb.gz	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
3	AFDB:Q91Z69	0.428	0.443	3.292E-96	1062	0.660	0.683	Q91Z69.pdb.gz	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
4	AFDB:D4A208	0.421	0.432	5.401E-87	1071	0.576	0.591	D4A208.pdb.gz	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
5	AFDB:Q8N264	0.174	0.254	1.391E-13	748	0.089	0.131	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
6	AFDB:Q7Z5H3	0.171	0.267	8.616E-13	698	0.105	0.165	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
7	AFDB:P42331	0.173	0.291	6.100E-12	645	0.085	0.144	P42331.pdb.gz	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
8	AFDB:Q8N103	0.168	0.250	1.552E-11	731	0.101	0.152	Q8N103.pdb.gz	TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens OX=9606 GN=TAGAP PE=1 SV=1
9	AFDB:A0A0A0MRJ9	0.177	0.218	2.027E-11	890	0.104	0.128	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
10	AFDB:A7KAX9	0.176	0.094	9.618E-11	2087	0.112	0.059	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
11	PDB:3cxlA	0.171	0.457	1.854E-10	402	0.056	0.152	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
12	PDB:6r3vA	0.172	0.901	4.932E-10	198	0.049	0.273	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
13	PDB:1xa6A	0.171	0.460	8.793E-10	399	0.053	0.145	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:5jcpA	0.147	0.436	3.228E-8	361	0.037	0.114	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.143	0.400	1.026E-7	382	0.039	0.113	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:3hajA	0.145	0.446	2.042E-5	286	0.039	0.150	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:3qwyA	0.050	0.317	6.003E-4	170	0.015	0.100	3qwyA.pdb.gz
18	PDB:6ikoA	0.155	0.471	6.003E-4	303	0.045	0.162	6ikoA.pdb.gz
19	PDB:1k9aB	0.050	0.122	2.848E-3	441	0.015	0.036	1k9aB.pdb.gz
20	PDB:2dybA	0.049	0.179	2.977E-3	298	0.018	0.067	2dybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVF0	0.0	775	965	0.371	0.423	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
2	A0A286YEY3	0.0	641	459	0.288	0.688	A0A286YEY3_HUMAN SLIT-ROBO Rho GTPase activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=1 SV=1
3	A0A8I5ZY52	0.0	747	921	0.360	0.430	A0A8I5ZY52_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
4	A0A8I6AIK5	0.0	756	934	0.363	0.427	A0A8I6AIK5_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
5	B7ZM87	0.0	1271	1070	0.591	0.607	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
6	D4A208	0.0	1262	1071	0.583	0.599	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
7	E7EQN5	0.0	804	925	0.367	0.436	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
8	O43295	0.0	2291	1099	1.000	1.000	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
9	O75044	0.0	1267	1071	0.591	0.606	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
10	P0DJJ0	0.0	632	459	0.284	0.680	SRG2C_HUMAN SLIT-ROBO Rho GTPase-activating protein 2C OS=Homo sapiens OX=9606 GN=SRGAP2C PE=1 SV=1
11	P98171	0.0	831	946	0.374	0.434	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
12	Q5VZB4	0.0	602	450	0.264	0.644	Q5VZB4_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
13	Q7Z6B7	0.0	1488	1085	0.682	0.690	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
14	Q812A2	0.0	2269	1099	0.985	0.985	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
15	Q8IXS7	0.0	663	335	0.291	0.955	Q8IXS7_HUMAN SRGAP3 protein OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=1
16	Q8K4G7	0.0	775	965	0.371	0.423	Q8K4G7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=2 SV=1
17	Q91Z67	0.0	1264	1071	0.583	0.599	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
18	Q91Z69	0.0	1422	1062	0.664	0.687	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
19	E9PCM6	2.77e-150	469	768	0.210	0.301	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
20	A0A8I6GIQ7	9.00e-144	452	770	0.212	0.303	A0A8I6GIQ7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	1e-18	78.8	Fes/CIP4, and EFC/F-BAR homology domain
2	PF02120 Flg_hook	1.7e+02	13.4	Flagellar hook-length control protein FliK
3	PF00620 RhoGAP	9.3e-44	160.3	RhoGAP domain
4	PF00018 SH3_1	5e-07	40.6	SH3 domain
5	PF07653 SH3_2	1.2e-05	36.3	Variant SH3 domain
6	PF14604 SH3_9	3.5e-05	35.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373347

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.965	Cell division control protein 42 homolog
2	9606.ENSP00000376368	0.950	Wiskott-Aldrich syndrome protein family member 1
3	9606.ENSP00000420321	0.934	Roundabout homolog 1
4	9606.ENSP00000417335	0.907	Roundabout homolog 2
5	9606.ENSP00000459615	0.884	SLIT-ROBO Rho GTPase-activating protein 2
6	9606.ENSP00000377197	0.816	Hydrocephalus-inducing protein homolog
7	9606.ENSP00000363436	0.812	G protein-regulated inducer of neurite outgrowth 2
8	9606.ENSP00000347198	0.808	SLIT-ROBO Rho GTPase-activating protein 1
9	9606.ENSP00000306129	0.773	D(1B) dopamine receptor
10	9606.ENSP00000474456	0.770	Neuroblastoma breakpoint family member 1
11	9606.ENSP00000320324	0.769	Puromycin-sensitive aminopeptidase
12	9606.ENSP00000320401	0.769	UDP-glucuronosyltransferase 2B17
13	9606.ENSP00000478609	0.768	Neuroblastoma breakpoint family member 1
14	9606.ENSP00000410603	0.734	Protein FAM131B
15	9606.ENSP00000460070	0.734	General transcription factor II-I
16	9606.ENSP00000422591	0.724	Slit homolog 2 protein
17	9606.ENSP00000416040	0.712	Belongs to the UPF0606 family
18	9606.ENSP00000360076	0.674	SH3-containing GRB2-like protein 3-interacting protein 1
19	9606.ENSP00000240874	0.658	Kalirin
20	9606.ENSP00000310829	0.654	Cilia- and flagella-associated protein 70

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0051056	0.914	regulation of small GTPase mediated signal transduction
GO:0016043	0.725	cellular component organization
GO:0050896	0.677	response to stimulus
GO:0051716	0.604	cellular response to stimulus
GO:0007165	0.545	signal transduction
GO:0032502	0.453	developmental process
GO:0048856	0.440	anatomical structure development
GO:0032501	0.429	multicellular organismal process
GO:0048518	0.429	positive regulation of biological process
GO:0048522	0.377	positive regulation of cellular process
GO:0007275	0.337	multicellular organism development
GO:0048519	0.309	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.966	membrane-bounded organelle
GO:0043229	0.963	intracellular organelle
GO:0043231	0.904	intracellular membrane-bounded organelle
GO:0005634	0.762	nucleus
GO:0016020	0.657	membrane
GO:0043233	0.375	organelle lumen
GO:0070013	0.371	intracellular organelle lumen
GO:0005654	0.335	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]